Slashdot Mirror


Word Up

theodp writes "Depending on your perspective, the National Scrabble Championship is a major sporting event, an unrivalled intellectual competition, or the world's biggest dork-fest. So says Slate's Dan Wachtell, who turned to an anagram-drilling Unix program to gain an edge on the 850+ competitors. While hardly mainstream, competitive Scrabble is getting newfound attention thanks to the publication of Word Freak and release of Word Wars."

208 comments

  1. Word is a registered trademark of Microsoft Corp. by Try+to+think+about+i · · Score: 0, Funny

    Thanks for your cooperation.

  2. Word To You, Bro by ackthpt · · Score: 5, Interesting
    Scrabble is getting newfound attention thanks to the publication of Word Freak and release of Word Wars."

    I like Scrabble so much, I keep running down the battery on my PDA playing the scrabble-like game on it. It gave me the low battery warning this morning so I had to read during lunch.

    I'll give these a look though, particularly Word Wars as even AVP wasn't as exciting as most alternative film is. Truth has a habit of being far more interesting than fiction, what with the boring repetitiveness of formula cinema.

    To Scrabble beginners, here's some advice: Make the best of the least letters. High scores can be achieved with 2 and 3 letter words and leave fewer openings for opponents. Study the Scrabble dictionary between games. RE, LA, NU are words ;-)

    When I heard that the end of wooden tiles was coming, I dashed down to the local game shop and scored one of those sets. I can't imagine playing this with plastic bits, not after my dad taught me the game ages ago. Call me tradition bound.

    Dork certainly is a fitting description of someone who turns to a computer to help them with words. It's a game of pitting intellect vs intellect, not intellect vs 'Fred'*.

    * Fred is a cycling term for wannabe, but with a strongly negative connotation

    --

    A feeling of having made the same mistake before: Deja Foobar
    1. Re:Word To You, Bro by civman2 · · Score: 1

      Unless the UNIX computer was his brain, the article makes no mention of his use an anagram finder...

    2. Re:Word To You, Bro by urlgrey · · Score: 5, Insightful

      I for one am quite glad to see the geeky, simpler games getting a bit of attention. Growing up I played this game with my parents at our kitchen table.

      I'm sure Scrabble ended up being a significant confidence booster for me, particularly when I started winning a few games.

      Whatever the case, it was a cool feeling for a kid to be able to get a feeling of being "just as smart" as his parents. (Hey, they may have thrown the game in my favor, but who's to say? I don't suspect they did, but nevertheless, it was a cool feeling.)

      Oh yeah, and three cheers for wooden tiles! :-D

      ----

      --
      Running 'Nix is like owning a Lightsaber. It's "a more elegant weapon for a more civilized time."
    3. Re:Word To You, Bro by vslashg · · Score: 3, Insightful
      Unless the UNIX computer was his brain, the article makes no mention of his use an anagram finder...

      From the article:
      So, in the weeks leading up to the competition, I crammed. Nightly, you could find me awake at 2 a.m. typing strings of letters into a Unix-based program that would quiz me on their anagrams. I took these quizzes until the wee hours of the morning, while my girlfriend slept soundly next to me.
    4. Re:Word To You, Bro by ackthpt · · Score: 1
      I for one am quite glad to see the geeky, simpler games getting a bit of attention.

      I'm pretty much at the other end of video games. All that interests me is strategy games now, FPS and stuff is in my past. I find I have a lot more fun playing board games, like Settlers of Cataan, Empire Builder (Russian Rails for 2-6 comrades, ETA late fall) and so on are much more rewarding. I never foresaw the day I would actually be playing games with bits of wood on cardboard, after all those scintillating colors and 5.1 sounds and stuff. Funny how that happened.

      --

      A feeling of having made the same mistake before: Deja Foobar
    5. Re:Word To You, Bro by svyyn · · Score: 5, Informative
      Unless the UNIX computer was his brain, the article makes no mention of his use an anagram finder...

      At the top of the article is a small menu with days of the week. Click on 'Mon' or http://slate.com/id/2105210/entry/2105211/. Took me a bit to find it too.

    6. Re:Word To You, Bro by Suppafly · · Score: 1

      apparently they give different copies of the article to different people since that who paragraph you've quoted isn't in the article.

    7. Re:Word To You, Bro by DumbWhiteGuy777 · · Score: 3, Informative

      In response to RE and LA being words, that's because they're on the music scale or something like that. DO, RE, ME, FA, SO, LA, and TI are all also words. And if you use or someone else uses them, you can pretty easily add onto them(E.G. RE one turn, then add QUIRE onto it, and that's two turns) and then you can rack up some big points.

      /Me is a closet Scrabble nerd

    8. Re:Word To You, Bro by NotQuiteReal · · Score: 3, Funny
      You say I can't imagine playing this with plastic...

      ...But you can play it on a PDA? Sheesh.

      --
      This issue is a bit more complicated than you think.
    9. Re:Word To You, Bro by thentil · · Score: 1

      The link in the write-up (http://slate.com/id/2105210/entry/0/) points to the most recent entry; the quoted text in the parent, and in the write-up, are from monday's entry (http://slate.com/id/2105210/entry/2105211/). When the write-up was done, tuesday's report probably wasn't up yet.

    10. Re:Word To You, Bro by poslfit · · Score: 1

      Dork certainly is a fitting description of someone who turns to a computer to help them with words. It's a game of pitting intellect vs intellect, not intellect vs 'Fred'.

      Playing Scrabble at a high level involves memorizing a large portion of the dictionary. Some Luddites do successfully do this without study software, but it's definitely the harder path to follow.

    11. Re:Word To You, Bro by poslfit · · Score: 1

      Right answer, wrong reason. Two-letter words are the building blocks of Scrabble because they're how you make parallel plays. To take an extreme example, suppose your opponent opens the game with the word "ABALONE" and you have "DYNAMOS" sitting on your rack. Where do you play it for the most points? You could hook the S to make ABALONES and DYNAMOS for 83 points, but you'd score 16 more points if you knew your two-letter words well enough to lay the word right underneath, making AD, BY, AN, LA, OM, NO and ES. The extra points come from the fact that you score each word and crossword that you make, and here eight words score more than two.

      Extending RE to make QUI-RE scores only for QUIRE. If you can fit QUIRE parallel to a word beginning with an R, making the crossword RE, you'll score for both QUIRE and RE.

    12. Re:Word To You, Bro by jb_nizet · · Score: 1

      High scores can be achieved with 2 and 3 letter words and leave fewer openings for opponents
      I agree with your advice. However, (at least here in France and in Belgium) real scrabble players always play in duplicate mode, where this kind of tactics (leave fewer openings for opponents) disappear along with the chance factor. Here's how it works.
      Every player has his own scrabble game. One of the players takes letters in a bag and tells all the other ones which letters he takes. All the other players take exactly the same letters. Then all the players try to find the best word, and at the end of the time, each player takes the score of his own word, but the word that is finally put on the board is the one that had the highest score. Then the cycle restarts.
      This way, no more chance factor!
      JB.

    13. Re:Word To You, Bro by stosh · · Score: 1

      >When I heard that the end of wooden tiles was >coming, I dashed down to the local game shop and >scored one of those sets. I can't imagine playing >this with plastic bits, not after my dad taught me >the game ages ago. Call me tradition bound.

      AND, you could cheat by reading the grain on the back of the wooden tiles. I knew _exactly_ what the back of the blanks, Q, X, etc. looked like.

      --
      Let my epitaph be. Karaaaaaaa. (JJ)
    14. Re:Word To You, Bro by poslfit · · Score: 1

      This way, no more chance factor!

      Which is why we don't play duplicate in English: we like the element of luck. Mind you, the "we" isn't monolithic. There's a sharp divide between North American players who like to bluff and insist that challenging an acceptable word should cost the challenger a turn, and the rest of the world where (for the most part) getting away with phoneys is considered underhanded, so challenging acceptable words incurs no penalty.

  3. I am glad by kc0re · · Score: 1

    I am glad that the someone referred to the scrabble competition as the "geek-fest", instead of G3, an Apple conference, Comdex, or Defcon. Using the Unix program to come up with words is for the weak (anyone know where i can get it?).. With the Olympics being the only thing on TV, they should make it an Olympic event.

    1. Re:I am glad by ackthpt · · Score: 3, Funny
      I am glad that the someone referred to the scrabble competition as the "geek-fest"

      I was taught some kid version of checkers, back in the day, and went on a family vacation to the Keewenau Peninsula (Eagle River, MI) where this whitehaired old hotel owner (The Swank Hotel -- his last name was Swank) was the county checkers champion. He schooled me and gave me no breaks. Never underestimate old men with board games, like checkers, chess, dominos or Scrabble, especially where they have months to pass (between tourist seasons) to hone their l33t sk1llz.

      --

      A feeling of having made the same mistake before: Deja Foobar
    2. Re:I am glad by Anonymous Coward · · Score: 0

      Olympic sport, eh? Just last night I was talking to a friend about how people are trying to get Bridge (the card game) to be an Olympic sport. We both noted that Scrabble might as well be an Olympic sport if Bridge is. Odd timing of this article.

    3. Re:I am glad by Dr+Reducto · · Score: 1

      He was using teh haxx. He's n0t 1337.

    4. Re:I am glad by Anonymous Coward · · Score: 0

      I was taught some kid version of checkers

      What the heck? it's checkers.. there's really not many way you can play it? how do you simplify checkers? Next you'll tell me about the 'baby way' to pay tic-tac-toe.

    5. Re:I am glad by Lehk228 · · Score: 1

      well you've got two or three row checkers, as well as various other initial configurations of pieces

      --
      Snowden and Manning are heroes.
  4. Unix Program For Scrabble? by Crzysdrs · · Score: 5, Funny

    Unix Program to play scrabble? That seems like overkill. Plus it would really make the game pointless for other players.

    L
    B O R I N G
    S
    P A T H E T I C
    R
    S A D N E S S

    1. Re:Unix Program For Scrabble? by ackthpt · · Score: 1
      Unix Program to play scrabble? That seems like overkill. Plus it would really make the game pointless for other players.

      Ah, but with a fixed random number sequence, so the gameplay is the same each time, this could be the Holy Grail of Yet-Another-Benchmarks someone could specifically tailor processors to excell at. ;-)

      --

      A feeling of having made the same mistake before: Deja Foobar
    2. Re:Unix Program For Scrabble? by mikael · · Score: 1

      There used to be a software version of Scrabble which allowed you to play against other players by E-mail.

      Scrabble assistant programs are somewhat useful. You enter the letters that you have and it provides a list of possible words that use all or nearly all of the letters. Good for reminding those obscure words, but you're probably better off browsing through the dictionary, reading books or solving the daily crossword.

      --
      Vintage computer adverts: http://www.vintageadbrowser.com/computers-and-software-ads
    3. Re:Unix Program For Scrabble? by nessus42 · · Score: 3, Informative
      There used to be a software version of Scrabble which allowed you to play against other players by E-mail.
      There still is:

      http://www.thepixiepit.co.uk/scrabble/index.htm
      Scrabble assistant programs are somewhat useful.
      You mean like

      http://www.a2zwordfinder.com/main.html

      ?

      |>oug
    4. Re:Unix Program For Scrabble? by Anonymous Coward · · Score: 0

      "Excel." The word is "excel."

  5. Spelling Bee by savagedome · · Score: 2, Interesting

    While we are talking about word fest and such, don't forget the National Spelling Bee

    ESPN telecasts and I always watch it :D
    Its pretty entertaining actually in a nerdy kind of way. (Isn't that the reason we are all on slashdot!)

    And Bill Simmons (The Sports Guy on ESPN) wrote an interesting diary too.

    1. Re:Spelling Bee by Anonymous Coward · · Score: 2, Interesting

      If you have enough interest to sit through a spelling bee, you should check out the movie Spellbound. It's a documentary that follows some kids all the way to the national spelling bee. I rented it because I thought it was going to be a Christopher Guest style mock-umentary, but found it pretty interesting. Some of the kids were pretty bizarre.

    2. Re:Spelling Bee by achurch · · Score: 1

      don't forget the National Spelling Bee

      And its wonderful dictionary, with words like ninnyish. I lost in my 6th grade school finals on that, and I'm still pissed about it. They could have at least picked words that exist!

  6. Re:Werd up by Anonymous Coward · · Score: 0
    Fo'shizzle mah nizzle.

    Coming to where-you-is-at soon, Scrabble: Urban Edition.
    Urban my a55, the only people you hear talk like that are white, middle class kids. Like to drop a few of them in Compton, just around dark..
  7. The pinnacle of acheivement by GeorgieBoy · · Score: 5, Funny

    You know you've reached the top when Slashdot calls your "sporting" event a "dork-fest". There is no higher complement.

    1. Re:The pinnacle of acheivement by Anonymous Coward · · Score: 0

      I suppose you meant "compliment", you word freak! :)

  8. scrabble americans by Anonymous Coward · · Score: 0

    Talk about a game us americans are pretty poor at. About the most difficult word I hear outta most people mouths during our off house is the popular SH*T.

    Anyway :P just had to put my 2 cents in.

  9. ... and the CSI episode by inio · · Score: 3, Informative
    competitive Scrabble is getting newfound attention thanks to the publication of Word Freak and release of Word Wars.

    ... And the CSI episode Bad Words

    1. Re:... and the CSI episode by L7_ · · Score: 1

      Actually, I think it was the episode of MTV Cribs with the newest 15 minute alt-rock band Maroon 5 stated how they have all thier "cool" friends over for a game of scrabble (that was all set up on thier dining room table).

  10. Girls!!!??? by DigiShaman · · Score: 2, Funny

    Will there be girls and nookie? Ohhh please please please...PLLLEEEASE.

    Ok, I'm a techno geek at heart. But this, THIS is just sad. Hell, if you are looking for a place to sacrifice virgins, you couldn't find a better place.

    --
    Life is not for the lazy.
    1. Re:Girls!!!??? by IGTeRR0r · · Score: 3, Funny

      I disagree. I've sacrificed three virgins because they saw me reading Slashdot. Of course, I don't think that's what you mean, but...

  11. Play now! by Anonymous Coward · · Score: 3, Informative

    The fellow @ www.themaninblue.com has an excellent javascript/dhtml version available online.

    see here

    I just stumbled upon it the other day, looking for ways to practice to beat my mother-in-law ;)

    1. Re:Play now! by Anonymous Coward · · Score: 1, Funny

      ... looking for ways to practice to beat my mother-in-law ;)

      May I suggest a cane?

  12. sporting event? by Anonymous Coward · · Score: 0

    I liked the post about the game scrabble... but what is the sporting event you mentioned?

  13. Big point scrabble words... by cr0sh · · Score: 3, Informative
    While not the biggest, a great "power word" is "fajita" - placed right (and make sure it is in your "agreed upon" dictionary) - this sucker can get you big points in one wallop.

    There are much better words out there, though - /.'ers, what are your suggestions?

    --
    Reason is the Path to God - Anon
    1. Re:Big point scrabble words... by itwerx · · Score: 3, Interesting

      ...make sure it is in your "agreed upon" dictionary...

      Words from any language are acceptable. Depending on who in my family is playing any given game can involve up to ten languages (more if you count things like Ye Olde English and Latin).
      Gets kind of interesting at times! :)

    2. Re:Big point scrabble words... by DrSkwid · · Score: 1


      does fanjita count ?

      --
      There are places where the networks are not touching,and there are places where they are-Boeing's Lori Gunter
    3. Re:Big point scrabble words... by elhaf · · Score: 2, Interesting

      I once got a 50-point bonus for using all my tiles, plus triple-word score and at least one double letter for "cousinly". You know, like motherly. Of course I was challenged, but I was fortunate that the dictionary we used had it explicitly listed under cousin. So I got about 90 points on just that one play. Of course I won that game.

      --
      Six score characters.
      Brevity being wit's soul
      I have enough space.
    4. Re:Big point scrabble words... by Paladine97 · · Score: 1

      Antidisestablishmentarianism?

    5. Re:Big point scrabble words... by TheGavster · · Score: 2, Informative

      'Ouija' is great for either bringing some vowels into play to get the game moving, or to tick off people hunting for vowels by sticking them somewhere inaccessible.

      --
      "Because Science" is one step from "Because old book". Try "Because of my experiment testing my falsifiable assertion".
    6. Re:Big point scrabble words... by Anonymous Coward · · Score: 4, Funny
      C
      O
      W
      ANONYMOUS
      R
      D
    7. Re:Big point scrabble words... by drinkypoo · · Score: 1
      I dunno, but I'd let you play fanculo. Extra points for 'fanocchio'.

      Note: this is not an overture.

      --
      "You're right," Fisheye says. "I should have set it on 'whip' or 'chop.'"
    8. Re:Big point scrabble words... by thejoelpatrol · · Score: 1

      That's a proper noun, though. A strict no-no with everyone I play.

    9. Re:Big point scrabble words... by Crazy_MYKL · · Score: 1

      "Muzjiks" is 128 points off the first draw.

      --


      <jedi> There is something funny here. You laugh. </jedi>
    10. Re:Big point scrabble words... by lavaface · · Score: 1

      also jonquil . . . yowza!!

    11. Re:Big point scrabble words... by fuctape · · Score: 1

      I hear 'antique' (or maybe 'antiquing') is a world record holder in official play.

    12. Re:Big point scrabble words... by Anonymous Coward · · Score: 0

      floccinaucinihilipilification?
      pneumonoultramicro scopicsilicovolcanoconiosis?
      Llanfairpwllgwyngyll gogerychwyrndrobwllllantysilio gogogoch?

    13. Re:Big point scrabble words... by K1-V116 · · Score: 1

      Harrumph...."pneumoultramicroscopicsilicovolcanoco niosis". Well, okay, it won't fit on a scrabble board, but it _is_ in the OED.... ;)

      --

      Got mead?

    14. Re:Big point scrabble words... by Anonymous Coward · · Score: 0

      Gorsafawddachaidraigodanheddogleddollonpenrhynareu rdraethceredigion?
      Krungthepmahanakornamornratana kosinmahintarayuttha yamahadilokphopnopparatrajathaniburiromudomrajaniw esmahasatharnamornphimarnavatarnsathitsakkattiyavi sanukamprasit?

    15. Re:Big point scrabble words... by poslfit · · Score: 2, Informative

      Antidisestablishmentarianism?

      Nope. Scores zero, because the Scrabble board is only fifteen letters wide. That wouldn't even fit on one of the new Super Scrabble boards. The highest scoring word in the tournament lexicon is OXYPHENBUTAZONE, which could score 1778 points under a rather unlikely set of circumstances.

    16. Re:Big point scrabble words... by itwerx · · Score: 1

      [sound of Scrabble tiles]

      What? Flocci's not a word!

      Yeah it is.

      Is not! Prove it!

      It's the plural of floccus of course.

      "Floccus of course", schmoccus a horse, I gotcher "floccus of course" right here!

      Why yes, yes you do, right on the top of your pointy little head...

      [sound of keys clicking]

      Doh!

    17. Re:Big point scrabble words... by keithdowsett · · Score: 1

      My favourites are the two letter words with high scoring letters, e.g. QI,ZO,AX,EX,XI,OX and JO. They are especially useful in parallel plays and are a big incentive to avoid placing vowels next to the triple letter squares.

    18. Re:Big point scrabble words... by pjt33 · · Score: 1

      I've played Boggle where you were allowed words from any language except English. But official Scrabble rules say that your word must be in a certain dictionary - I think it's Chamber's.

    19. Re:Big point scrabble words... by Anonymous Coward · · Score: 0

      You should play in only the language the scrabble game was made for, as the letter scores are defined for just that language (will differ because some letters are used more or less in different languages)

    20. Re:Big point scrabble words... by ebh · · Score: 1

      I was once one letter away from a triple-triple (or "nine-timer" in British parlance) JONQUILS through the O, but I had an A instead of the I. That would have been worth 356 points.

      The highest triple-triple I've actually played was REDWOoDS through the first D (the second O was a blank) for 194.

      Another high play came with its own poem:

      The first blank is an N
      The second a U
      The word is UnQuOTED
      For one twenty-two

      (It was a double word score with the Q on the triple letter score.)

    21. Re:Big point scrabble words... by poslfit · · Score: 1

      In Canada and the United States, it's the Official Scrabble Players Dictionary, or its tournament equivalent, the Official Tournament and Club Word List.

      In the rest of the world, it's currently Chambers (from which Official Scrabble Words is culled), but will soon change to Collins.

    22. Re:Big point scrabble words... by rev063 · · Score: 1

      My best play (and I really, truly, got to play this), was CONQUERS for (IIRC) 311 points. The C and S were on triple-word-score tiles and the Q on a double-letter-score tile. Score 29 for letters (with Q counting double at 20), multiply by nine (for two triple-words), and add 50 for the bingo. (I think I had a blank, so maybe knock off 9 points.) I've never come close since. It was a *very* lucky play, since it relied on my opponent laying the E at the right time and place. She's never forgiven me for that move. :)

    23. Re:Big point scrabble words... by itwerx · · Score: 1

      ... the letter scores are defined for just that language...

      Look, buddy, when I've 4 of the letter "A" I start talking Hawaiian damn fast! :)

    24. Re:Big point scrabble words... by Anonymous Coward · · Score: 0

      How can it score 0 if it won't fit on the board?
      You can't score if you're not on the board!

      Hahah!

  14. slashdot team by Turn-X+Alphonse · · Score: 1

    Wheres the slashdot team? :o

    We need a team of the greatest geeks ever to win it in our name.... but then they might stop reposting the same articles with thousands of speeling mistaks and we'd lose our respect for them

    --
    I like muppets.
    1. Re:slashdot team by 0racle · · Score: 1

      You might want to rethink that. Have you seen some of the spelling around here? It can be pretty bad, mine included.

      --
      "I use a Mac because I'm just better than you are."
    2. Re:slashdot team by Anonymous Coward · · Score: 0
      STFU FUU! WTF R U T3LK1NG ABTU?

      (lameness filter is like a pretty butterfly that eats a haiku)

  15. Best Online Scrabble by john.mull · · Score: 5, Informative

    The best online scrabble can be found at Internet Scrabble Club. Usually several hundred or more players online at any given time from around the world. Multiple dictionaries from several languages and even a UK British dictionary. Very fun, playable from Linux and MacOSX via a Java applet (in the browser?), elsewise a quick download of a java applet for Windows. Many very highly rated national and international players are playing right now.

    From the website:

    The ISC is the best place on the Internet to play Scrabble in a relaxed friendly environment. You can compete at your own level in English, French, Romanian, Italian, or Dutch while meeting new people and making friends from around the world.

    Right now there are 2138 players logged into the ISC and 792 games in progress.

    --
    Isaiah 43:19 (NCV)
    Look at the new thing I am going to do. It is already happening. Don't you see it?
    1. Re:Best Online Scrabble by heptapod · · Score: 1

      If you go to almost any MOO you can find a game of Scrabble along with many people who are up for a game. Plus LambdaMOO has Boggle which is a fine game in its own right. Just @go #6299 for Boggle or create a kid of #42261 for Scrabble.

    2. Re:Best Online Scrabble by haluness · · Score: 1
      > playable from Linux and MacOSX via a Java applet
      > (in the browser?), elsewise a quick download of a
      > java applet for Windows

      Actually, you can also get a jar file that will run on Linux (I use the blackdown JVM). Unfortunately the ISC webpage does'nt mention this anywhere - I had to mail Carol (the admin) to get it.


      In hindsight, if I had'nt found it I might have been able to finish my PhD faster :-


      BTW, I'm jijog on isco.ro, so if you're online challenge me

    3. Re:Best Online Scrabble by Noordijk · · Score: 1

      Actually, there's a Java client for Mac OS X too, it's just (inexplicably) buried in the site at http://www.isc.ro/mac/

    4. Re:Best Online Scrabble by ebh · · Score: 1

      ...which means that statistically, about 400 people are at this precise moment accusing their opponents of cheating for playing SATINE bingos.

  16. Big point scrabble words...For the birds. by Anonymous Coward · · Score: 0

    The names of cities and birds.

    I use to embarass others by going for the big words, while others were getting the easy ones.

  17. Er, most scrabble freaks ARE girls by Anonymous Coward · · Score: 2, Interesting
    Take a look at the article. Estimate the gender proportion.

    Women tend to like word games more than men do. Scrabble competitions are mainly composed of housewives reinvigorated after a life of raising kids by this game.

    It's what bridge used to be.

    The problem is that these are saggy, married girls. *sigh*

    1. Re:Er, most scrabble freaks ARE girls by rev063 · · Score: 1
      Women tend to like word games more than men do. Scrabble competitions are mainly composed of housewives reinvigorated after a life of raising kids by this game.
      Actually, according to the documentary Word Wars, competitive Scrabble players are 90% male. The speaker claimed it was because Scrabble is in fact an analytical "math/puzzle"-like game, rather than a creative "writing"-like game, and better suited to the competitive nature of men.
    2. Re:Er, most scrabble freaks ARE girls by poslfit · · Score: 1

      According to the documentary Word Wars, competitive Scrabble players are 90% male

      Word Wars is a fine film, but that's an exaggeration and a little out of context. Division 1 at the recent National Championship consists of those players who are competitive enough that they think they might be the best in the country. The average player in the group scores 390 points per game. 86% of them are men.

      There are however six other divisions whose average score drops successively by roughly ten points. In Division 6 (340 and falling...), 69% of the players are women. And don't think that they're any less competitive!

  18. Obligatory Critic Quote by MagicDude · · Score: 4, Funny

    Duke- "Quyzbuk"

    Marty-"That's not a word"

    Duke - "(dials phone) Get Webster on the phone. Noah, how ya doing? It's Duke. How much would it cost to make Quyzbuk a word? (pause) I don't what means, uh, how about a big problem? Great! How about that other word I invented, Dukelicious? No ones using it? What a Duketastrophe."

  19. sporting event by Anonymous Coward · · Score: 2, Interesting

    It's always great to see the word sport devalued even more to where it is essentially a synonym with 'game.' Hemingway said "Auto racing, bull fighting, and mountain climbing are the only real sports ... all others are games." While he was an overrated fuck and there are probably a few things to add - nothing involving an otherwise inanimate ball - it is kind of sad that anything and everything is now called a sport. I guess we need to invent a new word to mean what sport used to mean.

  20. scrabble/literati cheats by Dr+Kool,+PhD · · Score: 1

    CGI scripts with source -- http://www.cs.ucr.edu/~snematbakhsh/cheats/cheat.h tml

  21. Not a sport, but... by lukewarmfusion · · Score: 5, Insightful

    Scrabble isn't a sport, but ESPN (Entertainment and Sports Programming Network) had coverage of a Scrabble tournament once. They can make anything interesting. There seemed to be so much drama... the guy had his letters (which we could see), and there were only so many words he could make with them. It was really exciting.

    It's the same reason that ESPN's hit such a nerve with World Series of Poker. What normally isn't that great to watch can be made a lot more fun when you're 1) in the know and 2) have overly excited and knowledgeable commentators guiding you through it.

    I can only imagine what else they'd try to cover.

    1. Re:Not a sport, but... by bgeiger · · Score: 1

      Too bad they couldn't do that for M:TG. I stayed up to watch a Magic tournament (and this was back when I played a lot) and it was horribly dull.

      --
      o/~ All God's children shall be free in Pirates of the Caribbean, when we reach that Magic Kingdom in the sky... o/~
    2. Re:Not a sport, but... by Anonymous Coward · · Score: 0

      It was really exciting.

      Please wait whilst I extract my eyeballs with a spoon.

    3. Re:Not a sport, but... by Otter · · Score: 1
      They can make anything interesting.

      My favorite is how ESPN2 manages to cover the Running of the Bulls in Pamplona with a constant stream of statistics. ("Age: 3 years, Home: Malaga, Weight: 1843 lbs" or, at the end, "Time: 6:02, Trampled: 22, Gored: 6")

      I still can't believe people watch 30 hours of poker, though, let alone watch it over and over for a year. And the worst part is that it's displaced the World's Strongest Man contest...

    4. Re:Not a sport, but... by r.jimenezz · · Score: 1
      I can only imagine what else they'd try to cover.

      I regretted a lot not being able to watch it, but apparently they also did great broadcasting the Kasparov/X3D Fritz chess match late last year:

      http://www.x3dchess.com/

      --
      The revolution will not be televised.
    5. Re:Not a sport, but... by poslfit · · Score: 2, Informative

      That was the 2003 Scrabble All*Stars. The event Dan is writing about, the 2004 National Championship, will be shown on ESPN in October. At least as long as I can stop reading this thread and return to helping work on the postproduction. Speaking of which, this time around, we have the ESPN crew who did the World Series of Poker working with us, so I'm very much looking forward to seeing the final product.

      By the way, if you want to see how Dan did at the NSC, or play through dozens of top-level games, check out the (shameless plug) event web site. Archived coverage of last year's All*Stars is also still available.

      John Chew, Webmaster, www.scrabbleassociation.com

    6. Re:Not a sport, but... by lngtones · · Score: 1

      I'm still waiting for solitaire myself.

    7. Re:Not a sport, but... by Anonymous Coward · · Score: 0

      All by yourself?

    8. Re:Not a sport, but... by chendo · · Score: 1

      It all depends how they show it.

      For example, I stumbled upon a manga (Japanese comic) a while ago named Hikaru no Go, which was about this kid who plays Go. Apparently, it has a huge following in Japan, so I picked it up......... and I got hooked. I even started playing go myself. Hell, I even went down to the local club, and at least five people there started playing Go cause of HnG.

      If they can make a board game like Go into a popular manga (also anime series)... they're probably capable of making -anything- interesting. In fact, most of the sports manga/anime take what I thought was a boring sport, and turns it into something completely out of this world.

      Prince of Tennis is one of the more crazier ones. Think tennis, and add crazy moves that are almost impossible to do in real life. Backspin serves, shots where the ball just hits the grounds and stops, shots that curl from one side of the court to another... crazy.

      Off the top of my head, there's a basketball one (Slam Dunk), and that's all I can remember. There's more, I can assure you.

      I'm probably gonna be modded off-topic for this, oh well.

      --
      Founder of Mirror Moon - Tsukihime Game Trans
    9. Re:Not a sport, but... by lukewarmfusion · · Score: 1

      Go (or Wei Chi) practically has its own channel in Japan. I didn't know what it was when I was there, but the year after I returned I learned how to play. It's a lot like watching chess, I suppose.

  22. The beautiful thing about Scrabble by Shoeboy · · Score: 1, Troll

    Is how it can help us become better Christians. The ability to spot patterns in seemingly random collections of letters is also key to understanding the hidden messages in the bible.

    It's all about the acrostics, man. I'm actually working on a unix program to parse the KJV and reassemble the spiritual truths contained in the first letter of each verse. Look for it on freshmeat.

    Yours in Christ,
    --Shoeboy

    1. Re:The beautiful thing about Scrabble by Anonymous Coward · · Score: 0

      Is how it can help us become better Christians. The ability to spot patterns in seemingly random collections of letters is also key to understanding the hidden messages in the bible.

      It's all about the acrostics, man. I'm actually working on a unix program to parse the KJV and reassemble the spiritual truths contained in the first letter of each verse. Look for it on freshmeat.
      Learn statistics, then run your program on 1,000,000 slashdot posts. It says, The end is near...

    2. Re:The beautiful thing about Scrabble by darkewolf · · Score: 1

      Sounds like something out of the movie Pi and also the practice known as 'Gemetia'.

      This link may interest you :)

      --
      "That is not dead which can eternal lie...."
      Nimheil
    3. Re:The beautiful thing about Scrabble by Anonymous Coward · · Score: 0

      Shoeboy returns!

  23. correct link by Anonymous Coward · · Score: 1, Informative
  24. Obligitory Simpsons Quote by ejaw5 · · Score: 5, Funny

    Bart: Here we go. Kwyjibo. [places his tiles] K-W-Y-J-I-B-O.
    Twenty-two points, plus triple-word-score, plus fifty points
    for using all my letters. Game's over. I'm outta here. [gets up]
    Homer: [grabs Bart with his left hand, holding a banana in his right]
    Wait a minute, you little cheater!
    You're not going anywhere until you tell me what a kwyjibo is.
    Bart: Kwyjibo. Uh... a big, dumb, balding North American ape. With no chin.
    Marge: And a short temper.
    Homer: I'll show you a big, dumb, balding ape! [leaps for Bart]
    Bart: [making his escape] Uh oh. Kwyjibo on the loose!

    --

    $cat /dev/random > Sig
    1. Re:Obligitory Simpsons Quote by Anonymous Coward · · Score: 0
      Bart: Here we go. Kwyjibo. [places his tiles] K-W-Y-J-I-B-O.
      Twenty-two points, plus triple-word-score, plus fifty points
      for using all my letters. Game's over. I'm outta here. [gets up]
      Homer: [grabs Bart with his left hand, holding a banana in his right]
      Wait a minute, you little cheater!
      You're not going anywhere until you tell me what a kwyjibo is.
      Bart: Kwyjibo. Uh... a big, dumb, balding North American ape. With no chin.


      Apparently Bart couldn't spell Kibo?
  25. Don't say fuck or bugger by DrSkwid · · Score: 2, Funny
    --
    There are places where the networks are not touching,and there are places where they are-Boeing's Lori Gunter
    1. Re:Don't say fuck or bugger by segfault7375 · · Score: 1

      Williams spoke with Wright and his opponent, David Gibson, then called an emergency meeting of the Scrabble Advisory Board

      The Scrabble Advisory Board?!? Man, and I thought that *I* never got laid :)

    2. Re:Don't say fuck or bugger by 4of12 · · Score: 1

      It's too bad, because making something interesting could be enhanced with a little realism.

      ESPN Commentator: "A couple of our viewers have called in to say that men's gymnastics is a pussy sport.

      "We're here with Joe who is going to attempt to do a hand stand on the still rings."

      (Joe scowls, slapping white dust onto his palms, getting ready to show the world that this gymnastics ain't nuthin....)

      "Joe is preparing to jump up and grab the rings. He's swinging.....higher.....higher......he's making his move into handstand...!...(Joe plummets clumsily headfirst to the floor) Ow! That's got to hurt!"

      Joe: "Fuck!"

      --
      "Provided by the management for your protection."
  26. I thought you said he used a UNIX program? by stratjakt · · Score: 2, Funny

    Quoth the article:
    I responded with GEY for 33 to go ahead 371-353. I have no idea what GEY means, in case you are wondering.

    --
    I don't need no instructions to know how to rock!!!!
  27. Has anyone... by Neo's+Nemesis · · Score: 2, Funny

    ever tried playing scrabble of *only* technical words? Very interesting.

    SLASHDOT = 1 + 1 + 1 + 1 + 4 + 2 + 1 + 1 = 12points

    Now thats one of the lowest scoring words...

    1. Re:Has anyone... by Anonymous Coward · · Score: 0

      Why not go for higher points and use SLASHAHOLIC?

    2. Re:Has anyone... by phraktyl · · Score: 4, Interesting

      Or, assuming you had one of the letters, say the 'L', on the board in the right spot, say the lower right hand of the board, this could end up as:

      S (1) --- On a triple word score
      L (1) --- Previously played
      A (1)
      S (1)
      H (4) --- for (8) on double letter score
      D (2)
      O (1)
      T (1) --- on triple word score

      Which comes out to 144 points. Not too bad for slashdot!

      Remember: In Scrabble, placement is everything.

      --
      Karma: Marginal (mostly due to the border around the website)
    3. Re:Has anyone... by shfted! · · Score: 1

      Hehe... but I thought the highest karma you could get on Slashdot was 50.

      --
      He who laughs last is stuck in a time dilation bubble.
    4. Re:Has anyone... by Anonymous Coward · · Score: 0

      That you took the time to figure that out is just gross.

    5. Re:Has anyone... by Anonymous Coward · · Score: 0

      Hey! Isn't 'Slashdot' a proper noun? Damn cheater...

  28. Hey, its on TV by egad_man · · Score: 3, Funny

    Right after the dodgeball championship on ESPN 8

    --
    Hmmm, I have 5 mod pts, its time to metamod, and on top of that I have to meta-metamod? When do I get to read slashdot?
    1. Re:Hey, its on TV by Anonymous Coward · · Score: 0

      The OCHO!

  29. Difficulty by zackeller · · Score: 2, Funny

    Wouldn't a computerized Scrabble player have the potential to become unbeatable pretty easily?

    Should we welcome our new, dictionary-using Unix overlords?

    1. Re:Difficulty by xedx · · Score: 1

      Scrabble would very easy for a computer. People need to have the words in their head so a computer needs the equivalent: a dictionary. Coupled with simple algorithms, an anagram solver plus strategic tile placement then a bruteforce method for the moves it will be unbeatable. Well if we can just memorize a dictionary and easily recall the words we probably have a chance in beating a computer. While CHESS does require more processing power and intuition it employs the same bruteforce technique to choose moves. As have been the dismay of AI researchers chess and scrabble taught little about AI that could mimic human like intelligence, strategy was missing. I think GO has replaced both the board games for AI reasearch.

  30. You Roc by ackthpt · · Score: 2, Funny
    "power word" is "fajita"

    Liked ROC, myself, until an architect friend pulled ADZ on me .. the bastard!

    --

    A feeling of having made the same mistake before: Deja Foobar
    1. Re:You Roc by Moofie · · Score: 1

      I wouldn't have let him get away with misspelling "adze". But that's just me. : )

      For the record, I call "Bullshit!" on the official Scrabble dictionary. It's full of prefixes and onomatopoeias. You want to play Scrabble with me? Bring your OED.

      --
      Why yes, I AM a rocket scientist!
    2. Re:You Roc by antic · · Score: 1


      DZO too I think. Great for expanding on ZO.
      Also, I think BRR and HMM are valid in the Commonwealth comps. I know all the 2-letter words pretty well (CH, ST, HM, QI, etc), and a fair few from the 3-letter lists.

      --
      'Thats they exact same thing a banana wrench monkey.'
    3. Re:You Roc by ackthpt · · Score: 1
      I wouldn't have let him get away with misspelling "adze". But that's just me. : )

      Well, I challenged, but they had a Scrabble dictionary and, for the record, had already verified it was in there. He or his wife had pulled it on some other unsuspecting schnook prior.

      It's their game, Selchow and Richter once, now Hasbro. Whatchagonnado?

      For the record, I to have an OED and it's among my prized posessions.

      --

      A feeling of having made the same mistake before: Deja Foobar
    4. Re:You Roc by Moofie · · Score: 2, Interesting

      Yeah, there you go. Scrabble dictionary is LYING.

      : )

      The thing that frustrates me the most about that damn thing is how inconsistent it is. I have a ///big/// vocabulary, in a couple languages, and lots of the words I want to use just aren't in that damn thing. Now, it's chock full of bogus not-words, of course. Foreign words in common use in English are often not there, but things like "un" count as words.

      OED or nothin'.

      --
      Why yes, I AM a rocket scientist!
    5. Re:You Roc by Spuffin · · Score: 1
      Well you may have meant something else by using ROC but it is an actual word. Defined by Merriam-Webster :
      Main Entry: roc
      Pronunciation: 'räk
      Function: noun
      Etymology: Arabic rukhkh
      : a legendary bird of great size and strength believed to inhabit the Indian Ocean area
    6. Re:You Roc by ackthpt · · Score: 1
      Well you may have meant something else by using ROC but it is an actual word. Defined by Merriam-Webster :

      ...
      : a legendary bird of great size and strength believed to inhabit the Indian Ocean area

      I used ROC in games (I remembered this from and old D&D computer game ;-) and surprised an honors professor by using it, I was challenged, they looked it up and he got the same def. as webster, except added: "Capable of carrying away Scrabble players."

      --

      A feeling of having made the same mistake before: Deja Foobar
  31. Re:Werd up by Anonymous Coward · · Score: 1, Funny

    Can we throw in a few corporate rappers too?

  32. Um, I don't think so by writertype · · Score: 4, Funny
    Since you're a geek at heart, your logic skills must be above par. Let's try a little thought exercise.

    Do you remember college? The arts classes you detested? Those classes enrolled humanities majors -- people who studied history, philosophy, theater, English literature -- you know, the people who used language and social skills to learn. Remember all the hotties in there? How eager they were to discuss Kant, feminism, and the impact of the Impressionist movement on French Romantic literature? Remember how insecure those girls made you feel?

    Here's a hint: those girls knew how to play Scrabble. And read Lord Chatterley's Lover. Think of it as CounterStrike for people who can carry on a conversation.

    (Oh, and Lord Chatterley's Lover is kind of like this weird encrypted ASCII porn. It, like, uses your imagination to generate images! And girls dig it!)

    1. Re:Um, I don't think so by DigiShaman · · Score: 0, Troll

      If it wasn't for the excessive amounts of pot and Sky Vodka...I might remember.

      On a serious note however, I value what people have to say of their own experences. I could give a damn about the kinda BS "Intellectuals" shove in their face only for them to come back and regurgitate it back at me.

      Keep it real, keep it clean, keep it pure. No liberal additives please.

      --
      Life is not for the lazy.
    2. Re:Um, I don't think so by Loadmaster · · Score: 3, Funny

      I remember college. I read Lady Chatterly's Lover there. How was the Lord's book?

    3. Re:Um, I don't think so by houghi · · Score: 2, Funny

      Oh, and Lord Chatterley's Lover is kind of like this weird encrypted ASCII porn.

      Is that a sequal or a prequal to "Lord of the Rings"?. Must be an old book from the time when gay ment happy.

      --
      Don't fight for your country, if your country does not fight for you.
  33. Why by cubicledrone · · Score: 4, Insightful

    Why is anything that involves knowledge or thinking beyond "which reality show is on tonight?" described by name-calling?

    --
    Business isn't willing to pay for products, innovation and careers, so we get brands, mortgage commercials and layoffs.
    1. Re:Why by Anonymous Coward · · Score: 1, Insightful

      Because people like seeing you spaz's like you get all worked up.

    2. Re:Why by Anonymous Coward · · Score: 0

      It's all part of the death of the superego. Anything driven by animal insticts is good and fun and healthy, anything contrary to them is unnatural, wrong, or just stupid.

      If you're only playing scrabble to get in with the scrabble babes (or guys), that's ok. A little strange perhaps, but at least you've got your perspectives right.

  34. Yahoo! Word Racer by Anonymous Coward · · Score: 0

    I wrote a similar tool to cheat^H^H^H^H^Hwin my way to the top of the leaderboard in Yahoo! Word Racer.

    The game is quite simple. There is a matrix of letters and you have to form words by traversing from letter to letter. Naturally the game screams for automation so I stepped up the challenge.

    The algorithm to generate words went through several iterations until I came up with the perfect data structure and an optimal implementation. It uses a trie structure for storing all the valid words. Then it stores all the results in a sorted list by score. The hard part was typing in the letters and then typing back the results to the Java Applet. It was too slow; people were scoring before I could type answers! More automation!

    I wrote a routine which would scan the screen and take a bitmap. I then performed OCR on the bitmap to determine the letters in the grid. From there I solved the puzzle and then sent the keystrokes to the window programmatically.

    So when the game starts I just hit a button and it computes in less than 10 milliseconds and sends out the results. Nobody even has a chance to see the board before I answer all possible words.

    Hahahahahaha. Needless to say I'm posting anonymously because I am quite infamous there ;-)

  35. Obsolete phrase by cubicledrone · · Score: 3, Interesting

    While hardly mainstream, competitive Scrabble is getting newfound attention

    "Mainstream" was rendered obsolete when search engines were invented. There is no such thing as "mainstream" or "mass market" any more. Detergent is a mass market. Everything else is non-mainstream.

    --
    Business isn't willing to pay for products, innovation and careers, so we get brands, mortgage commercials and layoffs.
    1. Re:Obsolete phrase by upsidedown_duck · · Score: 1

      My dictionary says that "mainstream" is simply "a prevailing current or direction of activity or influence." Windows Update, for better and worse, is mainstream. Worshiping UFO-bearing comets hoping to be taken to another galaxy is not mainstream. I'm not convinced that Google changes this. It is possible to create a scope for what is mainstream, as in "UFS is a mainstream filesystem among UNIX systems," but increasingly the general public really wouldn't care, meaning that it is possible to make the scope sufficiently small to render something not mainstream (back to worshipping UFO-bearing comets).

      --
      -- "Makes Little Debbie look like a pile of puke!" - Moe Szyslak
  36. Bah.. Best Scrabble Ever by Anonymous Coward · · Score: 0

    I just finished a game of strip Scrabble with a nice hot woman. Every 10 points you take a drink, and every 25 points you take off an article of clothing. By the time I had my socks off, she was naked and performing sexual favours. Being a geek is the best.

  37. Anagram-drilling Unix program by wviperw · · Score: 2, Interesting

    I guess I missed the part in the article about the anagram-drilling Unix program.

    On that same not, how are computers at playing Scrabble anyway? I would think that they'd be pretty good at it, since they could just generate a list of potential anagrams, check them in a dictionary, and then use a maximize function which would search a couple moves deep for the best scoring path.

    --
    Nothing disturbs me more than blind loyalism towards some unrealistic and over-idealistic notion of one's nationality.
    1. Re:Anagram-drilling Unix program by olaugh · · Score: 1

      Computers are very, very good at Scrabble, within a few points per game of perfection. Finding all the possible moves is a trivial task, and strategy is based mainly on Monte Carlo simulations, except when the bag is empty, then it's alpha-beta like in Chess.

      The best humans are also very good, and many expert players insist that they are better than the strongest computer player, but computers have won all of the recent matches.

      John O'Laughlin

      PS
      I ended up in 34th place at this year's NSC. I had a good shot at finishing in the money but went 0.5-2.5 the last afternoon. I also wrote my own anagram-drilling program and was cramming on seven and eight letter words on the plane, at breakfast, after hours... we don't fool around. :)

    2. Re:Anagram-drilling Unix program by rev063 · · Score: 1

      A Scrabble program isn't as trivial as you might think, though. Simply going for the move which gets you the highest score from any given rack isn't the optimal strategy. Especially when all your options are low-scoring, holding back certain letters or getting rid of troublesome ones, at the expense of a few points this round, can pay big dividends next turn.

      On the other hand, a program has the advantage of being able to remember which tiles have been played and which are in the bag without having to worry about the clock...

    3. Re:Anagram-drilling Unix program by Lehk228 · · Score: 1

      do a full tree AI, incorporating all knowlege the computer has about the game state predict the flow of the game out untill there is insufficient data to have a reasonable guess, then choose the path which has the greatesd difference in points betweeen computer and opponent.

      --
      Snowden and Manning are heroes.
    4. Re:Anagram-drilling Unix program by poslfit · · Score: 1

      choose the path which has the greatest difference in points between computer and opponent

      Sounds obvious, but doesn't always work. Probability of winning correlates well with expected equity (net effect on difference in score at end of game), but there are situations that come up reasonably frequently where they rank candidate moves differently.

      For instance, move A might give you a 10% chance of winning the game but every loss is a close one, while move B might give you a 20% chance of winning the game but all the losses are big. You'd generally want to pick move B on its winning percentage, not move A on its maximizing the expected value of your score minus opponent score.

      Actual tournament situations get hairier. At the recent NSC, one player needed to win two straight games against the same opponent by a combined spread of at least 200 point to make it to the finals.

  38. Word up is the codeword... by BlueJay465 · · Score: 0, Redundant

    I thought Cameo was only a one-hit-wonder, until I had the misfortune of seeing that stupid video of Posh Spice, or whoever the hell that was who covered this song last.

    I hereby banish this discussion back to the 80's!

  39. Literati by DeadBugs · · Score: 1

    I play Literati on Yahoo Games

    a pretty good scrabble clone. At any given time there can be more than 10,000 people playing. Although sometimes it will not allow you to use words that dictionary.com (the site it uses to check) will find.

    --
    http://www.kubuntu.org/
  40. UNIX program? Easy! by MasterOfMagic · · Score: 2, Insightful

    I was in CS 1 class last semester, and this was the second program we did. We took a list of words (usually /usr/share/dict) and a set of tiles, and printed out words that matched, as well as their score. Really trivial stuff - any freshman CS undergrad could do it.

  41. hi by Anonymous Coward · · Score: 0

    nerd up

  42. I proposed that way by AssFace · · Score: 3, Interesting

    My fiancee and I played Scrabble every night, sometimes multiple times a night. And yes, we were fully aware of the nerd factor there.

    When I proposed to her, it was via the ring in the tile bag.

    I later found out that some crappy movie with JLo also had a Scrabble proposal in it, but I haven't seen said movie.

    We play less Scrabble these days mainly due to less free time.

    --

    There are some odd things afoot now, in the Villa Straylight.
  43. Alan, can you hear me? by Anonymous Coward · · Score: 0

    I know you're out there. :)

  44. Re:Werd up by Anonymous Coward · · Score: 0

    What have you got against the A55 Trunk Road across North Wales?

  45. Red Dwarf Followup by drinkypoo · · Score: 1

    LISTER: (Pointing to letters in his rack) That letter, that letter, and that letter. (Pointing to the middle of the board) There.

    We see that he is having the first go and we see his rack which has the letters D-A-T-E left on it.

    CAT: Hey! I've got you now! (Holding out his letters up for LISTER to see.) Jozxyqk.
    LISTER: That's not a word.
    CAT: It's a cat word.

    LISTER attempts to pronounces the cat "word."

    CAT: That's not how you pronounce it!
    LISTER: What's it mean?
    CAT: It's the sound you get when you get your sexual organs trapped in something

    CAT demonstrates with his hands a book shutting and pronounces the word again.

    LISTER: Is it in the dictionary?
    CAT: Well, it could be. If you were reading in the nude and you closed the book too quickly.

    --
    "You're right," Fisheye says. "I should have set it on 'whip' or 'chop.'"
  46. cheat if u cant beat by Anonymous Coward · · Score: 0

    hah

    isnt this the same as doping athletes, steroids in body builders, and printing your own money if you dont have enough...all cheats, no matter how you want to excuse it...

  47. Scrabble...a sporting event?!? by Anonymous Coward · · Score: 0

    Whats next, basic math as an olympic sporting event?

    Whoever can apply BEDMAS the fastest wins gold!

    1. Re:Scrabble...a sporting event?!? by poslfit · · Score: 2, Interesting

      Whats next, basic math as an olympic sporting event?

      Well, there is one Scrabble player who has won both the U.S. and Canadian National Championships, who was also a gold medallist at the International Mathematical Olympiad. But no, he's not big on sports.

  48. The sport of scrabble... by Anonymous Coward · · Score: 0

    I love playing my favourite sport, scrabble, out at the local sports arena.... It's probably the most physically intense sport out there and personal injuries while playing scrabble are very common. I find the competition is very fierce and physical intimidation is quite common.

    Last night I was watching scrabble on the local sports channel here. It was an intense battle of physical strength and endurance, similar to a boxing match (only better).

    I think scrabble should be added to the next summer olympics because it is the best "sport" out there...Right up there with "sport" fishing and "sport" car races... /end sarcasm

  49. Re:UNIX program? Easy! by Anonymous Coward · · Score: 5, Interesting

    It's not trivial... The tricky part is in the fast generation of valid scrabble words. This is made relatively quick by use of a TRIE or DAWG (Directed Acyclic Word Graph). Basically a DAWG is an efficient data structure where each letter of the alphabet is linked down to each subsequent letter that forms, or is on the way to forming, a valid scrabble word. Nodes where words are formed are marked as such. (Diff between a TRIE and a DAWG is that a DAWG is optimised so that all common endings (ING, ED etc) are stored once and pointed too, rather than a TRIE where it is not optimised.

    This means that the lookup for any combination of characters on the board / in the rack is blazingly fast. Want to check the string 'getgstsd' for validity? Well, g passes, ge passes, get passes, getg... Bzzzzt. Wrong, no valid words down this path! Next please.

    This is MUCH faster than a traditional binary search, and when you are checking typically thousands of existences per valid board location per move, it's worth it.

    All this ignores the nasty recursive algorithms to identify valid placement options, considering that placing a word may create invalid words along the opposite axis - so any extra words created need to be checked for validity too.

    I ended up writing a program to play scrabble and it used a feedback mechanism on several criteria (number of tiles used, place in game, ahead or behind status, number of premium squares used, number of premuim squares opened up etc) to weight future decisions. I'm a very good player and this program very quickly destroyed me. It was fascinating though to watch it play itself.

    Back in the day it was running on a 486dx2/66 and took about 2 seconds per move so it was possible to watch the games develop.

    I still have the code somewhere (in PASCAL!)... I really should break it back out and get it to compile on something new.

    Cheers - N

  50. Where is a poll when you need it? by maddskillz · · Score: 1

    I personally vote for World's Biggest Dorkfest

  51. UGH by cookiepus · · Score: 2, Funny

    I don't have a problem with the game of scrabble, and I can imagine playing it on a rainy afternoon if you're somewhere in the boonies, but what I DO have a problem with the scrabble culture!

    First of all, these people set up dates to play scrabble and then they meet up. In other words, they're commited to playing scrabble on, say, Sunday at 3pm, even though it's finally not a rainy weekend and the boyfriend wants to go to the beach and chill out, but no, she has to go play scrabble because she has a scrabble appointment.

    This is unhealthy. Like I said, nothing wrong with a game of scrabble on a rainy afternoon but when the weather is nice the last thing you should be doing is sitting on your ass with fucking letter tiles.

    Second, it destroys your brain. These people see a bunch of letter barf and see some random word in it. A normal person sees AHIVDLWVDIJBE and these sickos go wow I can spell "INTERCONTINETAL" with that. Quintuple letter score. You're not supposed to think like that. You're supposed to see AHIVDLWVDIJBE and say "you know what FUCK THIS I am going to the beach"

    Okay I guess I am a bit bitter because I am dating the international scrabble champ or whateverthefuck and it's cutting into my beach time.

    1. Re:UGH by mollyhackit · · Score: 1

      My brother plays D&D on sunday twice a month. My sister-in-law just says "he's dorking" when people asks where he's at. I don't know why scrabble is so geeky. You don't need to know english to play the game. All you need is a huge list of words and an ability to evaluate what the best placement is.

  52. You can't spell that on television by tiltowait · · Score: 2, Interesting

    The Scrabble tourney was in the news of the weird last week because someone legally played "LEZ" but had to take it back because the match was televised. At least he went on to win anyway.

    1. Re:You can't spell that on television by poslfit · · Score: 1

      That's a bit of a misinterpretation of what happened. NSC Finalists Trey Wright and David Gibson had both agreed to play the best-of-five finals without using words that ESPN would not televise. In the heat of the moment, at this position, Trey forgot and played LEZ for 32 points. My wife, who was sitting beside him recording his plays, brought the word to the attention of the tournament directors, who spent a good ten minutes verifying that the correct course of action was to set everything (clocks, tiles, board) back the way it was before he made the play and let play continue from there.

    2. Re:You can't spell that on television by kookbox · · Score: 1

      Something similar happened back in 1990 with Good Morning America and DARKIES, which was edited to DARKENS for broadcast. The event is mentioned in 'Word Freak,' but here's a link anyway.

      While I'm at it, here's a list (and one with definitions) of words removed between the second and third editions of the Official Scrabble Player's Dictionary. The third edition is often referred to as the Expurgated Scrabble Player's Dictionary for just this reason.

  53. Mod Parent +Funny by handy_vandal · · Score: 1

    It's all about the acrostics, man. I'm actually working on a unix program to parse the KJV and reassemble the spiritual truths contained in the first letter of each verse.

    Made me laugh!

    -kgj

    --
    -kgj
  54. Nerd Alert! by ackthpt · · Score: 1
    Will there be girls and nookie? Ohhh please please please...PLLLEEEASE.

    You know you're really a geek -- when you gaze at a well played Scrabble board like it was pr0n.

    --

    A feeling of having made the same mistake before: Deja Foobar
  55. The pinnacle of something, anyhow by devphil · · Score: 1


    Apparently the grand champions of this game take it a little too seriously to be happy, but I suppose the same can be said of a lot of endevours.

    --
    You cannot apply a technological solution to a sociological problem. (Edwards' Law)
  56. Simpsons by Feztaa · · Score: 2

    "KWIJYBO... a big, fat, dumb ape with only 3 hairs on his head"

    1. Re:Simpsons by EricWright · · Score: 1

      If yer gonna quote the Simpsons, at least get it right:

      Bart: Kwyjibo. Uh... a big, dumb, balding North American ape. With no chin.
      Marge: And a short temper.
      Homer: I'll show you a big, dumb, balding ape!
      Bart: Uh oh. Kwyjibo on the loose!

  57. obligitory... by Anonymous Coward · · Score: 0

    Where's the CowboyNeal option?

    Or would that be dorkfest?

  58. No way by nsuccorso · · Score: 0

    the world's biggest dork-fest

    This is the world's biggest dork-fest.

  59. what are you idiots laughing at by Anonymous Coward · · Score: 0

    computer gamers tend to become unemployed techs
    Scrabble players tend to become filthy rich lawyers
    Who is getting laid now suckas.

  60. Re:UNIX program? Easy! by MasterOfMagic · · Score: 1

    I used a TRIE, for the record. ;-) I was one of those who was an over-acheiver. I did the binary search version as a freshman in high school.

  61. You also get 50 points extra... by zoney_ie · · Score: 1

    ...for using all your letters.

    So a grand total of 194 points.

    --
    -- *~()____) This message will self-destruct in 5 seconds...
    1. Re:You also get 50 points extra... by phraktyl · · Score: 1

      I knew I was missing something in there.

      Nice catch!

      --
      Karma: Marginal (mostly due to the border around the website)
  62. No unix.. but Have Spacesuit Will Travel? by mattr · · Score: 1
    Neat game, scrabble. I loved it, would like to try a unix version. However there was no mention of anything to do with computers, the link does not point to a unix anagram program either. The author had interesting coverage of a tournament (first scrabble one on Slashdot? if so it is worth it) though it does seem a bit self flattering.

    More info on how ordinary mortals can train themselves to perform at this level, in particular how does he memorize words like gey without knowing what they mean? (Does he have a just have a kind of photographic memory but not care what words mean? Is this not bad?) Anyway I am going to have to look on freshmeat..

    .. 20 seconds later .. so maybe we are talking about Anaquiz which seems to help you memorize the dictionary (is this why he doesn't know words' meanings but knows which are legal?) The anaquiz screenshot is quite intriguing. I think the story link to the unix program must be anaquiz.

    I see also the Judge scrabble adjucation system, and Scrabaid which seems to be a scrabble coach.. any other links to tools for improving memory (I remember a mnemonic trainer story a year ago) would be interesting.

    For example in a story of Robert Heinlein's called Have Spacesuit Will Travel in which an engineer teen hacker successfully refurbishes a spacesuit and later makes good use of the distances of the planets from the Sun which he had luckily memorized with a cool limerick. Any other modern limericks or ways to memorize constellations and other astronomical phenomena would be quite useful if anyone knows of them.

    1. Re:No unix.. but Have Spacesuit Will Travel? by pjt33 · · Score: 1
      so maybe we are talking about Anaquiz which seems to help you memorize the dictionary (is this why he doesn't know words' meanings but knows which are legal?)
      Most tournament-level Scrabble players know lots of words without knowing their meanings.
  63. Nice try by geekoid · · Score: 1

    I'm don't think you can use a proper noun.
    you get ZERO! hahah hahaha

    --
    The Kruger Dunning explains most post on /. http://en.wikipedia.org/wiki/Dunning%E2%80%93Kruger_effect
    1. Re:Nice try by poslfit · · Score: 1

      Okay, so suppose you had SLASHDOT on your rack. Then if there were an F in the right spot, you could play HOLDFASTS through it for 212 points. And maybe get an extra turn when your opponent unsuccessfully challenged the word. But more likely, they'd ask you why you had eight tiles on your rack instead of seven, and you'd lose your turn instead.

    2. Re:Nice try by Lars+Clausen · · Score: 1

      Ah, but "slashdot" has been a verb for quite a while now. Or can't you use verbs that are also proper nouns (like hoover or jimmy)?

      -Lars

    3. Re:Nice try by poslfit · · Score: 1

      You can, as soon as they make their way into one of the recognized (printed) source dictionaries. Hoover is good in Chambers, jimmy is good in several dictionaries. If you want to get slashdot into Merriam-Webster, start clipping whenever you see it used in print, and mail your clippings in to them. (Uh-oh, I have visions of their mailbag getting slashdotted...)

  64. Eye hayt skrabable by Elivs · · Score: 2, Funny

    Eye all ways loose.

    Shirely eyem knot teh ownly /. rieder wif ah spelang probablem.

    Elivs

  65. You forget by geekoid · · Score: 1

    You let some liturature dork chat them up, and then when she's had a few, and the dork has lost his nerve, You swoop in and score.
    Thats why I show up to parties late.

    See, using ones brain to get Real sex.
    I'm sure the book was as good though...[yeah right]

    --
    The Kruger Dunning explains most post on /. http://en.wikipedia.org/wiki/Dunning%E2%80%93Kruger_effect
  66. Read Word Freak for instant self esteem... by Hellad · · Score: 1

    I read the book Word Freak this summer and it was shocking to me just how nerdy people can be. I don't mean this in a bad way, but it would make the geeks on here feel like captain of the football team in terms of "coolness"...

  67. Re:UNIX program? Easy! by Anonymous Coward · · Score: 1, Informative

    There's at least one implementation of all this stuff on Sourceforge: xwords.sourceforge.net. It includes DAWG-building tools in perl and apps in C for Linux (GTK or ncurses), PocketPCs and Palms.

  68. is all a Dud by Anonymous Coward · · Score: 0

    Peggy Hill is nowhere to be found on the referred pages, therefore, I don't recognize any of their champions.

  69. Regular Scrabble bores me... by Flint+Dragon · · Score: 1

    ...but Speed Scrabble rocks! Never played it? Try this:
    1. throw away the game board
    2. turn all the tiles upside down in the middle of the table and shuffle them
    3. every player picks 7 tiles
    4. on "go", everyone turns over their tiles and tries to use up all the tiles on their own personal puzzle
    5. when a player is able to use all of the tiles in their possession legally, he yells "go" and everyone draws two more tiles.
    6. play continues until there are no more tiles and a player uses up all his tiles in his puzzle.

    Try it...it's a blast.

  70. Re:UNIX program? Easy! by tobias.sargeant · · Score: 2, Informative

    two:

    quixotic

    In fact, quixotic implements a more complex datastructure than a DAWG, called a GADDAG which allows exceedingly fast word building, starting in the middle of the word. This means that if you also have a list of all the anchor squares -- those squares where playing a tile automatically makes a syntactically valid play -- you can generate all possible plays given a rack without ever generating an illegal play.

    My 800MHz powerbook finds moves fast enough that it's feasible to do a couple of plys of a form of speculative minmax in order to evaluate the worth of particular board positions.

  71. Re:UNIX program? Easy! by Superfluid+Blob · · Score: 2, Informative

    There's a very clever method of optimising the repeated valid placement calculations, due to Jacobson and Appel, where each square is tagged with the set of valid crossing letters that can be played on it. For example, if your board looked like:

    1.2.3
    A.N.D
    L.O.O
    E.W.E

    where 1 2 and 3 were empty squares, 1 would be tagged with {bdeghkmprstvwy}, 2 with {aeks} and 3 with {}, so that a word played horizontally would be constrained to have only those letters in the tagged squares. (SOWPODS lexicon)

    Combined with this is a refinement of the DAWG called a DAGGAD - in the author's words:

    A practical variation is the DAWG for the language L = {REV(x)*y | xy is a word and x is not empty}, where * is just a delimiter. Each word in the lexicon can be generated starting from each letter in that word by placing tiles leftward
    upon the board starting at an anchor square while traversing the corresponding arcs in the structure until encountering the *, and then placing tiles rightward from square to the right of the anchor square while still traversing corresponding arcs until acceptance. Being the reverse of the directed acyclic graph for prefixes followed by the directed acyclic graph for suffixes, I called it a GADDAG.


    So for example, the word SPACE would be stored as SPACE, PACE*S, ACE*PS, CE*APS and E*CAPS, so that you could search the tree starting from the A, play C in the next square, E next, then jump back to the A, move back a square and play P, then back another square and play S. After the trie compaction, a DAGGAD takes up ~3-5 times the space of the corresponding DAWG, and roughly doubles the search speed.

    Check out Graham Toal's wordgame programming page for lots more on scrabble algorithms.

  72. Yeah, I can play scrabble too... by Anonymous Coward · · Score: 0
    That doesn't mean I go to the national championships.

    Surely your logic skills are sufficient to understand that the set of people who can play scrabble is larger than the set of people who do. The set of active players is larger than the set of people who play in tournaments.

    Look at the photos on the official site, see how many of those women you'd like to date.

    That's an established culture thing, just as the Masons don't have many young members right now. Whatcha gonna do?

    1. Re:Yeah, I can play scrabble too... by poslfit · · Score: 1

      Look at the photos on the official site, see how many of those women you'd like to date.

      The demographics for the National Championships are skewed in favour of people who have a serious enough commitment in the game to want to devote a week to a tournament. The median age at this event was 50 and only 10% were under 30.

      That's not generally true of serious Scrabble though. I'm sure nubile women are overrepresented among online Scrabble players, and if you look at events like the National School Scrabble Championship, the players there are all underage.

  73. Re:UNIX program? Easy! by Flyboy+Connor · · Score: 1
    Ah, but was it any good?

    Brian Sheppard wrote the Scrabble-playing program Maven. Maven consistently beats human Scrabble world champions. And the fun part is: the program is based mainly on statistical values for letter occurrences. This means that the English Maven can be converted into a foreign-language Maven, simply by loading the dictionary and let the computer generate the statistics for the dictionary. At his Ph.D. defense, Sheppard demonstrated this by loading a Dutch dictionary into the program, and let the program play against the Dutch Scrabble champions. The humans were wiped off the board.

    For me, this only goes to show that Scrabble is not a very interesting game...

  74. scrabble? geeky? dorky? wtf? by Anonymous Coward · · Score: 0

    I don't know what kind of dorky geek
    thinks scrabble is geeky or dorky.

    scrabble taught GOOD ENGLISH :)

    Spelling bees are FING RETARDED,
    but scrabble? it beats a word-a-day calendar
    every day

  75. "sporting" event AND a "dorkfest" by weighn · · Score: 1
    Depending on your perspective, the National Scrabble Championship is a major sporting event, or [a] dork-fest

    Let's get Scrabble into Beijing 2008 and gnomedex 2004.
    Dork-Jocks of the world - unite!

    --
    Mongrel News all the news that fits and froths
  76. Re:Why (it is part of the slashdot ecosystem) by gosand · · Score: 2, Insightful
    Why is anything that involves knowledge or thinking beyond "which reality show is on tonight?" described by name-calling?

    I thought so at first, but consider the source of the insult. This is Slashdot, you have to toe the line and like what everyone else likes. Obviously many of the rubes who haunt this place aren't very well rounded people. They think spelling is unimportant. They love anime, Star Trek, LOTR, and acronyms.

    Or perhaps this story is just following a trend I have noticed. Slight jabs within the posted story to "fire up" the discussion. After all, the people who post responses to the discussion make up the bulk of Slashdot's content. Without the discussion, there isn't much to see here. The diatribes, rants, quips, and flames are the fuel for further diatribes, rants, quips and flames. And the occasional informed post. I mean, just look at my first paragraph. You think that won't get a few responses? :) That is just how things work around here.

    --

    My beliefs do not require that you agree with them.

  77. Damn it, so close... by Vraylle · · Score: 1

    I saw "Word Wars" and thought for a moment: "Woohoo, a plug for my game!" Curse the luck. No shameless plug for me.

    --
    Mutant Freaks of Nature: "Frighteningly Addictive"
  78. After I Zoquo, I like to Ushnu by Anonymous Coward · · Score: 0

    I feel so old...

  79. Scribble by EyesWideOpen · · Score: 1

    Scribble (http://snoot.org/toys/scribble) is entertaining as well; I play it often. It's a cooperative Scrabble-type game where players take turns playing (you can't play twice in a row from the same IP) to acheive the highest score. You get ten tiles per rack instead of seven so there is a great potential for very high scoring words.

    --

    As with the sun's light
    My mom was magnificent
    Unquestionable
  80. Re:UNIX program? Easy! by poslfit · · Score: 1

    Well... given that top English players can still give Maven a run for its money, I think your anecdote says more for the quality of Dutch Scrabble players. The best English players have a history of decades of strategic theory development, excellent study tools and a pool of other top players to hone their skills against. And a lot of them practise against Maven all the time.

    Brian's PhD thesis is a must-read for anyone interested in board game AI though, and is a fascinating description of the state of the art in Scrabble software.

  81. Great Computer Scrabble by Anonymous Coward · · Score: 0

    I have found that the best playing Scrabble program currently is the funkitron Scrabble. You can download it here. It has a Scrabble AI called MAVEN which plays a pretty amazing game. At perfect level it is pretty much unbeatable though I keep on trying.

  82. GEY by anaplasmosis · · Score: 1

    "Gey" is a proper noun (it's someone's name) and therefore not allowed....

  83. Re:Best Scrabble Computer Player by Anonymous Coward · · Score: 0

    I have found that the best playing Scrabble program currently is the funkitron Scrabble. You can download it here. It has a Scrabble AI called MAVEN which plays a pretty amazing game. At perfect level it is pretty much unbeatable though I keep on trying.

  84. open source scrabble for PDAs by Anonymous Coward · · Score: 0

    There's a cool multi-player open source scrabble clone that runs on Linux and various PDA OSes, for free download here: http://xwords.sourceforge.net. -- Software is like sex, it's better when it's free. -- Linus Torvalds

  85. Excel is a registered trademark of Microsoft Corp. by Anonymous Coward · · Score: 0

    Thanks for your cooperation

  86. Wild Pieces by Notright · · Score: 1

    Reminds me of my Uncle who would turn over pieces to make the them look like wilds. His wife never quite understood why he got all the wilds!

  87. "Lord" Chatterley? by sczimme · · Score: 1


    I am fairly certain that was 'Lady Chatterley's Lover', if you were thinking of the scandalous-in-1928 D.H. Lawrence novel. Apparently there was a male version (Lord vice Lady) but that was published the wacky 1970s - NFI.

    --
    I want to drag this out as long as possible. Bring me my protractor.