Slashdot Mirror


PC Historian Finds Puzzling Game Diskette Image

This past weekend, Trixter — a self-proclaimed IBM PC historian — picked up some old software for his archive. What he didn't count on was a couple of additional Avantage titles that had never been released into the wild. If this weren't enough of a find, one of these titles provided Trixter with an interesting puzzle: the diskette for Mental Blocks is apparently hand-formatted to work on both C64 and IBM (on a single side, not the "flippy disks" of old). Quite an interesting little piece of history.

232 comments

  1. Tiltowait by Anonymous Coward · · Score: -1, Offtopic

    Tiltowait

    1. Re:Tiltowait by Anonymous Coward · · Score: -1, Offtopic

      AC needs Kadorto now!

    2. Re:Tiltowait by argent · · Score: 4, Funny

      That was the first game that I pirated... after I bought it.

      The copy protection was so messed up that the only way I could get a copy of the game that was reliable was a cracked copy. But I didn't want a pirated diskette, so I had the cracked copy written over the original gold-labelled floppy.

    3. Re:Tiltowait by LowlyWorm · · Score: 1

      I remember those days well. The 1541 and to a lesser extent 1571 disk drive copy protection schemes used to introduce errors by reading or writing on tracks outside the range of the drive heads, This made them knock continuously to jump tracks. This always knocked them out of alignment.

      --waxing nostalgic

      --
      Time flies like an arrow. Fruit flies like a banana.
  2. Hybrid disks - not a novel idea after all! by Drakkenmensch · · Score: 2, Insightful

    *looks at his hybrid Blizzard game disks and smiles* It goes to show that these days, everything new is an old idea!

    1. Re:Hybrid disks - not a novel idea after all! by Hatta · · Score: 5, Insightful

      Do those disks really use multiple formats, or do they just have Mac and PC binaries available on the same standard ISO file system?

      The cool thing here is the media format itself is a hybrid. C64 disks in general are incompatible with DOS disks. But some clever hacker out there figured out a way to build a file system that's valid for both machines. A better analogy would be formatting a disk so that it's ext3 and NTFS *at the same time*.

      --
      Give me Classic Slashdot or give me death!
    2. Re:Hybrid disks - not a novel idea after all! by Yvan256 · · Score: 1

      Your Blizzard "game disks" are CDs or DVDs, not diskettes. Most software CDs and DVDs these days use the same file system, no matter what the target operating system is.

    3. Re:Hybrid disks - not a novel idea after all! by Feanturi · · Score: 4, Interesting

      It's also shockingly cool because my understanding of C64 vs. IBM formatting indicates that the read/write method is entirely different between the two, making it physically impossible for one machine to run emulation to extract info from a drive of the other.

    4. Re:Hybrid disks - not a novel idea after all! by blueg3 · · Score: 5, Interesting

      The "Macintosh-format" CDs don't use ISO, they actually use HFS/HFS+. The dual-format disks actually contain an ISO and an HFS partition, but they're engineered so that they share data. You can have ISO-only files, HFS-only files, and shared files; the shared files are only stored once. The ISO partition is used to store data for windows; the HFS partition is used to store data for Mac OS.

      The interesting thing about those disks isn't that they're formatted to have two different filesystems on them -- by the time the dual-format CDs were around, putting two partitions on a disk was no big shocker. The interesting part was that they were designed to have two partitions own the same data.

      Compare with the disk mentioned in the article. It sounds like the data for the IBM and C64 are entirely separate. The interesting feature is making what is essentially a two-partition disk out of a disk that's designed to be single-partition.

    5. Re:Hybrid disks - not a novel idea after all! by blueg3 · · Score: 2, Informative

      See my response above -- "Mac/PC" hybrid disks actually use two different filesystems. Macintosh CDs use the HFS/HFS+ filesystem. People took advantage of this to make dual-filesystem hybrid disks. (On the other hand, having two partitions with different filesystems on one disk was old hat by the time data CDs were around.)

    6. Re:Hybrid disks - not a novel idea after all! by Amouth · · Score: 1

      yeap.. and this is why this is "new for nerds" someone spent some time on this.

      i would love to know how they went about it - seems like it would be an intresting read

      --
      '...if only "Jumping to a Conclusion" was an event in the Olympics.'
    7. Re:Hybrid disks - not a novel idea after all! by Otto · · Score: 4, Interesting

      You think that's neat... This was back several years before XP came out, but I once found a 700 MB image for a CD that had installations for like 15 different versions of Windows, from 95 to 98 to NT4, all on the same disc. Including all the Pro and Server and other versions and everything else.

      Basically somebody had sat down and ran a big comparison on all these to find the shared files, then engineered a disc to have all these different partitions own that shared data, allowing for installation of any of them. Then they went a step further and wrote a boot sector to let you boot any of those partitions via a simple text choice at boot time. The result was a single disc that could install any version of Windows that was available at the time.

      Had that disc for years, came in extremely handy.

      --
      - Give a man a fire and he's warm for a day, but set him on fire and he's warm for the rest of his life.
    8. Re:Hybrid disks - not a novel idea after all! by billcopc · · Score: 2, Funny

      So that person's claim to fame was using ISOBuster to save an "optimized" ISO ?

      Wow.

      No really, I'm impressed. I mean, it took some serious cojones to actually click that checkbox.

      --
      -Billco, Fnarg.com
    9. Re:Hybrid disks - not a novel idea after all! by Otto · · Score: 0

      Never heard of "ISOBuster", nor can I find any reference of it being about to do anything like WTF you are talking about via Google.

      So.. [citation needed].

      --
      - Give a man a fire and he's warm for a day, but set him on fire and he's warm for the rest of his life.
    10. Re:Hybrid disks - not a novel idea after all! by OTDR · · Score: 1, Interesting

      I can see how a flippy -- a SS disk modified to be recordable on both sides via a second sleeve notch ( made many of these myself) -- could support both formats but I doubt a single side could. IIRC, Commodore 1541 diskettes used an electromagnetic encoding technique called GCR while IBM diskettes used MFM. The two were mutually incompatible. Later Commodore drives like the 1571 (for the C128) were programmable on-on-the-fly to be able to read IBM disks (anyone remember "Big Blue Reader"?).

      I can't see how a single disk could support BOTH encoding techniques on a single side.

    11. Re:Hybrid disks - not a novel idea after all! by Anonymous Coward · · Score: 5, Informative

      It's also shockingly cool because my understanding of C64 vs. IBM formatting indicates that the read/write method is entirely different between the two, making it physically impossible for one machine to run emulation to extract info from a drive of the other.

      The trick is that, if you limit each OS to half of the disk, you can do this. Each OS only uses its half and doesn't try to read or understand the other's.

      IBM-standard floppies put the master directory information on the first tracks on the disk. Commodore floppies put this information on track 18 of 35, halfway in. (Fun note: you could actually run out of directory space if you put a bunch of small files on the disk and filled up track 18. There were utilities that would extend the directory links to track 19 in this case.)

      So tracks 1-17 were the IBM part, and 18-35 were the C-64 part. No shared data. I think Commodore floppies only stored 110 K of data.

    12. Re:Hybrid disks - not a novel idea after all! by Anonymous Coward · · Score: 2, Insightful

      ISOBuster 1.0 came out after Windows XP. The GP was talking about "several years before XP". Probably not an automated process back then.

      Now? We have a torrent with all Windows installation CDs. It fits conveniently on two DVD9s.

    13. Re:Hybrid disks - not a novel idea after all! by KillerBob · · Score: 3, Informative

      to install W95, you needed about 60MB worth of CAB files. The rest of the stuff on the disc could safely be ignored. W98 and 98SE were 95MB. ME was 130. NT4 was 55MB. W2K was 120 or so.

      I had (and still have) a CD that I made, which included W95 OSR2, W95 OSR2 French, W98SE, W98SE French, and NT4 English/French install discs, all on a single 650MB disc. And I'll go one better: because of options that were available in the install ini files, they were all headless installs, and didn't need me to choose any options or enter a product key. :)

      --
      If you believe everything you read, you'd better not read. - Japanese proverb
    14. Re:Hybrid disks - not a novel idea after all! by CronoCloud · · Score: 3, Informative

      The Commodore 1541 floppy drive stored 170K

    15. Re:Hybrid disks - not a novel idea after all! by MacTO · · Score: 1

      > A better analogy would be formatting a disk so that it's ext3 and NTFS *at the same time*. A better analogy would be formatting a disk so that it can be used in a plain old audio CD player and DVD video player. When you look at a Commodore 64 and a PC floppy diskette, it isn't so much the file systems are different (they are different, but that is beside the point here) but how the bits are encoded on disk. Even though we like to think of computers as digital systems, they are intrinsically analog. That is to say that the most digital parts of the disk are the heads and the tracks. After that, it is an analog signal that is being read from the media. Certain patterns in that analog signal are interpreted to mean certain things in the digital domain by the electronics, which is how it is translated into a digital form.

    16. Re:Hybrid disks - not a novel idea after all! by Sproggit · · Score: 3, Insightful

      Yes YOU cant see how it can be done, nor can most of us.
      Thats why its interesting, because it would require hand crafting two entirely different format types on the same physical medium ... quite a lot more technically difficult than simply using half the tracks for one OS, and the other half for the other.
      Please read TFA before attempting to sound insightful.

    17. Re:Hybrid disks - not a novel idea after all! by infinite9 · · Score: 2, Informative

      It wasn't so much that the formats were different as it was the controllers. The catweasel can write to both formats using a standard 1.2mb 5.25" PC floppy drive.

      --
      Disconnect your television. Do your own research. Draw your own conclusions. They're probably lying. Don't be a sheep.
    18. Re:Hybrid disks - not a novel idea after all! by Anonymous Coward · · Score: 0

      Isn't that called a partition? If that's considered new, I'm patenting the idea!

    19. Re:Hybrid disks - not a novel idea after all! by banzaikai · · Score: 5, Insightful

      {Sigh}

      Okay, folks, here's how you do it...

      1) Format using 1541. This will put 174K of data on the bottom side of a DSDD floppy.
      2) Manually edit the Block Allocation Map (BAM) to map out ALL tracks/sectors between 0 and 17, leaving track 18 (the BAM) and 19-35 for the 64 program and data (I figure about 82K will be free).
      3) Write 64 stuff to disk.
      4) Pop disk into PC drive, and either use a custom utility, or just use the FORMAT command specifying that only tracks out to 17 be formatted (FORMAT A: /T:17 /N:9). This allows BOTH sides of the disk to be formatted up to track 17, giving you about 180K to play with. Given the lousy graphics on PCs at the time, this is all you really need. This WILL NOT overwrite any 1541 formatting, since the BAM sits at track 18, and the FAT sits at track 0.
      5) write PC stuff to disk.
      6) PROFIT!

      Another person above wondered if the 1541 had an auto-remap of bad sectors... NOPE. A bad disk/sector would trigger the "headbanger" routine, and the format would fail. In fact, the reason the 1541 was so slow at formatting (about 2 minutes for 174K) was that it would write the track, then read it back to verify, update the BAM, then go back to do the next track. Fastload cartridges bypassed the verify and BAM routines, and could do the same thing in under 30 seconds.

      Seriously, am I the only one here who read "Inside 1541 DOS" by Immers and Neufeld?

      banzai "Bam-Bam" kai

    20. Re:Hybrid disks - not a novel idea after all! by Proudrooster · · Score: 1

      Technically, no, partitions share a common partition table and are aware of each other. This is a case of formatting the same disk twice making sure that one format didn't overwrite the other.

    21. Re:Hybrid disks - not a novel idea after all! by TBadiuk · · Score: 1

      I don't think it was done that way though. That's what I initially though (what you wrote, which would be dead easy), and I'm not sure why it wasn't done like this. The actual disk seems to have the data interwoven so you have alternating tracks of IBM and C64 data. Either that or I'm misunderstanding what Trixter wrote...

      Ted

    22. Re:Hybrid disks - not a novel idea after all! by Annymouse+Cowherd · · Score: 1

      Did you write some assembly to display a menu giving you the option of which version to install, and then boot the correct one without triggering any copy-protection

    23. Re:Hybrid disks - not a novel idea after all! by Annymouse+Cowherd · · Score: 3, Informative

      to install W95, you needed about 60MB worth of CAB files.

      No, I have Win95 on 13 floppy disks = 18.72MB.

    24. Re:Hybrid disks - not a novel idea after all! by Anonymous Coward · · Score: 0

      Heh, it must hurt being so wrong.

      Also, I'd like to see YOU code your own CD boot sector (I can :)

    25. Re:Hybrid disks - not a novel idea after all! by tanmanX · · Score: 0

      one of my friends had something like this, his had DOS to XP or something, was on a DVD though. He lost it or something.

    26. Re:Hybrid disks - not a novel idea after all! by Anonymous Coward · · Score: 0

      where's the torrent for this?

    27. Re:Hybrid disks - not a novel idea after all! by Anonymous Coward · · Score: 0

      The discrepancy is probably original Win95 versus the later versions which included IE/WMP/AOL and so on.

    28. Re:Hybrid disks - not a novel idea after all! by Trixter · · Score: 3, Informative

      4) Pop disk into PC drive, and either use a custom utility, or just use the FORMAT command specifying that only tracks out to 17 be formatted (FORMAT A: /T:17 /N:9). This allows BOTH sides of the disk to be formatted up to track 17, giving you about 180K to play with.

      Right, except that, if you actually read the post, you'd know that what I found was that every even track != 0 was C64 and every odd track *and* the entire second side was IBM.

      I mean, come on, I posted a FAT dump as a screenshot. So no, it wasn't truly that easy (even though our definition of "easy" is a lot different than most people's). It required a little more planning, and manual patching of *both* filesystems.

    29. Re:Hybrid disks - not a novel idea after all! by whereiswaldo · · Score: 2, Informative

      I think Commodore floppies only stored 110 K of data.

      They stored 160 KB per side of a 5-1/4" disk. These were accessed by the 1541 and 1571 drives.

      The 1581 drives stored 800 KB per 3-1/2" disk. You could even partition the disk as I recall!

      *sigh* those were the days...

    30. Re:Hybrid disks - not a novel idea after all! by cheekymunky · · Score: 1

      Not that it'll make up all the space, but weren't Windows 95 disks in that MS High-Density format as well, 1.68Mb (?) per floppy?

    31. Re:Hybrid disks - not a novel idea after all! by Hal_Porter · · Score: 1

      Windows NT 4.0 supported x86, Mips, Alpha and PowerPC. I read somewhere that the installation CD was packed - files common to all architectures where only stored once in the ISO image. If you copied the files off the disk, the resulting image was too big to burn unless you had an ISO image packer.

      --
      echo -e 'global _start\n _start:\n mov eax, 2\n int 80h\n jmp _start' > a.asm; nasm a.asm -f elf; ld a.o -o a;
    32. Re:Hybrid disks - not a novel idea after all! by Otto · · Score: 1

      Well, "several years" might be a bit high. It was after 98 came out, I'm sure of that. And Google tells me that XP was released in 2001. So.. Probably 1999.

      --
      - Give a man a fire and he's warm for a day, but set him on fire and he's warm for the rest of his life.
    33. Re:Hybrid disks - not a novel idea after all! by multipartmixed · · Score: 1

      664 blocks at 256 bytes, not including the directory, which means 169984 bytes. 170K in harddrive math, 166K by everybody else's math.

      --

      Do daemons dream of electric sleep()?
    34. Re:Hybrid disks - not a novel idea after all! by encopitt · · Score: 1

      Can anyone give me data on whether there were pro or server versions of ANY of those OS's? Seriously man. Put the bong down. Bragging about shit on /. is comparable to masturbation.

  3. In my day, we had to hand format disks by Anonymous Coward · · Score: 5, Funny

    With a tiny magnet, flipping 1's and 0's.

    1. Re:In my day, we had to hand format disks by porkchop_d_clown · · Score: 5, Funny

      You had magnets!?!

      We had rub our fingers against piece of sheepskin really fast to build up a static charge and then touch the bits to flip them!

    2. Re:In my day, we had to hand format disks by Anonymous Coward · · Score: 5, Funny

      you had ones AND zeros? We only had zeroes. We were too poor to afford all those ones. We had to just close our eyes and imagine the ones. When we finally got a few ones, we had to use them sparingly and reuse them, we only had 8 ones between all us kids, and when we wanted to format our disks, we had to format then one byte at a time, then recycle those ones. SUre, you might occasionally get lucky and get to do a few bytes at the same time, but those solid blocks of 255s used to kill us. Spoiled rotten damn rich kid,

    3. Re:In my day, we had to hand format disks by CFBMoo1 · · Score: 1

      Ugha... me day me used rock hammer and stone chisel. Had lift disk with legs not back. Ughha... Dump in river ruined disk... buga... damn erosion. ughaaa!

      *Beats stick on ground*

      --
      ~~ Behold the flying cow with a rail gun! ~~
    4. Re:In my day, we had to hand format disks by morgan_greywolf · · Score: 5, Funny

      Disks? Huh. You kids and your newfangled "disks". Why, in my day, we had paper tape. Except we were too poor to have a tape puncher, so we had to use a pencil! And we were too poor to own a pencil sharpener, so when the pencil broke, we had to use our teeth!

      Now get off of my lawn!

    5. Re:In my day, we had to hand format disks by The+Great+Mooch · · Score: 5, Funny

      You kids and your new fangled paper tape. In my day we had to chew the wood into a pulp to make the paper to make the cards we had to use.

      Now get off my lawn.

    6. Re:In my day, we had to hand format disks by richie2000 · · Score: 5, Funny

      You have a lawn? Spoiled brat!

      --
      Money for nothing, pix for free
    7. Re:In my day, we had to hand format disks by JeanBaptiste · · Score: 5, Funny

      You had fingers!?!

      I'm not even going to tell you how we charged our sheepskins.

    8. Re:In my day, we had to hand format disks by Anonymous Coward · · Score: -1, Redundant
    9. Re:In my day, we had to hand format disks by DigitAl56K · · Score: 4, Funny

      You had wood? .. wait, on second thoughts I don't like where this is going ..

    10. Re:In my day, we had to hand format disks by Hurricane78 · · Score: 4, Funny

      Let me guess... Hillbilly style, from behind? :D

      --
      Any sufficiently advanced intelligence is indistinguishable from stupidity.
    11. Re:In my day, we had to hand format disks by Anonymous Coward · · Score: 5, Funny

      And that's the reason there are so few famous female programmers.

    12. Re:In my day, we had to hand format disks by Kratisto · · Score: 5, Funny

      You have Italics? In *my* day, the only way to show emphasis on the internet was to put asterisks on either side of the word. Do you youngins have any idea how much sarcasm went unnoticed back in the day?

      --
      Conscience is the inner voice which warns us that someone may be looking.
    13. Re:In my day, we had to hand format disks by jonadab · · Score: 1

      You had sheepskins?

      --
      Cut that out, or I will ship you to Norilsk in a box.
    14. Re:In my day, we had to hand format disks by Pharmboy · · Score: 1

      Ever since Microsoft patented ones and zeros, formatting them is much harder...

      --
      Tequila: It's not just for breakfast anymore!
    15. Re:In my day, we had to hand format disks by SevenHands · · Score: 1

      I imagine it's his parents' lawn...

    16. Re:In my day, we had to hand format disks by nomadic · · Score: 1

      With a tiny magnet, flipping 1's and 0's.

      You were spoiled, in my day we only had 0's.

    17. Re:In my day, we had to hand format disks by richie2000 · · Score: 2, Funny

      we used to dream of asterisks not to mention all punctuation those were not even invented back in the day

      --
      Money for nothing, pix for free
    18. Re:In my day, we had to hand format disks by kitsunewarlock · · Score: 1

      Lead 'em up to a cliff side and they'll back up on ya.

      --
      Ginga no Rekshiya Mata Each page.
    19. Re:In my day, we had to hand format disks by I'm+not+really+here · · Score: 0, Redundant

      Real disk writers use butterflies.

      --
      Before commenting on the Bible, please read it first
    20. Re:In my day, we had to hand format disks by atomicthumbs · · Score: 1

      inmydywddnthvspcsrnyfthsvwlsytk4grntd

      --
      http://pinopsida.com
    21. Re:In my day, we had to hand format disks by digitig · · Score: 3, Funny

      Paper tape? Eee, tha' were lucky. In my day we had to toggle the loader in on front panel switches.

      The disturbing thing is that it's true, I *am* that old.

      --
      Quidnam Latine loqui modo coepi?
    22. Re:In my day, we had to hand format disks by ohxten · · Score: 1

      You had butt cheeks?! We all had to get metal plates inserted into our heads and wait for a lightning storm as our source of static electricity.

      --
      Need an automatic screenshot taker? Try here.
    23. Re:In my day, we had to hand format disks by operagost · · Score: 1

      01000100 01100001 01110010 01101110 00100000 01101011 01101001 01100100 01110011 00100001

      --

      Gamingmuseum.com: Give your 3D accelerator a rest.
    24. Re:In my day, we had to hand format disks by Idiomatick · · Score: 1

      nmwhvnfhhrlfrgrn .... I think i took it one too far......

    25. Re:In my day, we had to hand format disks by pcgabe · · Score: 4, Interesting

      That takes me back...

      I had a cartridge for my C64 that let me do low-level stuff with disks. With it, you could browse around and read the raw sectors, change stuff, lots of fun. It wasn't long until I discovered that most C64 disks followed a certain pattern with regard to which sectors followed which (very rarely were they sequential; I think it was next-track-over+six-blocks-down). The first two bytes (iirc) pointed to the next sector. [This didn't work for copy-protected games that didn't use the standard format. If those disks went bad, you were SOL]

      Interestingly, I found that when sectors went bad, they often went bad in exactly the same way: all the bytes for that sector would be shifted back one, and the first and last bytes were the same on every bad sector. I can't remember what they were now (first byte was "M", last was "Z"? Damn 20-years-ago memories...), but you could spot a bad sector by looking at it.

      Effectively, only the information about the following sector would have been lost, but you couldn't just put it back in because everything had shifted over by one. And if you manually shifted everything back by one (by retyping it all in, starting from the end), and re-saved, you'd usually fuck up the sector even more, and lose data.

      My solution was to browse around on the disk until you found an empty sector. Copy all the data from the old sector on to a piece of paper, go to the new sector, type it all back in, point it at what the next sector should be (following the standard pattern), save it all to make sure it's not a bad sector, go back to what the previous sector should be, and point it away from the bad sector to the new replacement sector.

      [The _real_ solution would have been to write a program to do this for you, but I didn't have any manuals and couldn't figure out which PEEKs and POKEs would give me the same functionality as the cartridge]

      Sometimes a bunch of sectors were bad, so you'd have to do this many, many times. I remember when I moved out after high school and found my notebooks filled with pages and pages of hex numbers; the raw data for all the sectors I moved around on disks, by hand.

      Good times.

      --
      Don't put advice in your sig.
    26. Re:In my day, we had to hand format disks by Anonymous Coward · · Score: 1, Funny

      ...could spot a bad sector by looking at it ... copy all the data from the old sector on to a piece of paper, go to the new sector, type it all back in ... notebooks filled with pages and pages of hex numbers...

      You're like some kind of super nerd. Like you were built in a laboratory out of parts from lesser nerds.

    27. Re:In my day, we had to hand format disks by Anonymous Coward · · Score: 0

      You had ALL OF THAT? Me and my dad had to design the universe from scratch: spatial dimensions, time, laws of physics... You kids have it all handed to you on a silver platter these days.

    28. Re:In my day, we had to hand format disks by Anonymous Coward · · Score: 0

      You had paper? I bet you even had a loader to read it.

      In my day we had to hand-toggle code into our PDP-8. And we considered ourselves lucky!

    29. Re:In my day, we had to hand format disks by maharvey · · Score: 1

      especially the part about chewing...

    30. Re:In my day, we had to hand format disks by maharvey · · Score: 1

      I got mglw'nafh and fhtagn but not the rest. Can you say it again without the tentacles in your mouth?

    31. Re:In my day, we had to hand format disks by ozbird · · Score: 1

      Punctuation cost extra STOP Now get off my lawn STOP

      (Damn lameness filter.)

    32. Re:In my day, we had to hand format disks by vehn23 · · Score: 1

      how do you make those letters that look 'bigger' and more 'formal', like the ones that you use to start sentences after periods/

    33. Re:In my day, we had to hand format disks by spir0 · · Score: 1

      01100001 01110010 01100101 00100000 01110111 01100101
      00100000 01101111 01101100 01100100 00111111

      --
      The reason girls and Windows users don't understand UNIX is because all the documentation is in Man files.
    34. Re:In my day, we had to hand format disks by Anonymous Coward · · Score: 0

      Shenanigans, Mr 7-Digit-UID

    35. Re:In my day, we had to hand format disks by initialE · · Score: 1

      No, that's the reason why women don't go to Slashdot.

      --
      Starbucks, Harbuckle of Breath.
    36. Re:In my day, we had to hand format disks by Anonymous Coward · · Score: 0
    37. Re:In my day, we had to hand format disks by pcgabe · · Score: 1

      ...could spot a bad sector by looking at it ... copy all the data from the old sector on to a piece of paper, go to the new sector, type it all back in ... notebooks filled with pages and pages of hex numbers...

      You're like some kind of super nerd. Like you were built in a laboratory out of parts from lesser nerds.

      I disagree!

      I didn't have any manuals and couldn't figure out which PEEKs and POKEs would give me the same functionality

      Clearly, I fail at nerding.

      --
      Don't put advice in your sig.
    38. Re:In my day, we had to hand format disks by uvajed_ekil · · Score: 1

      You had the internet? In my day, the only way to flame your friends and make sarcastic comments was in person. A lot of sarcasm still went unnoticed, but the flames were just as obvious, since a good ol' hotfoot can get anyone's attention.

      --
      This is a hacked account, for which the owner can not be held responsible.
    39. Re:In my day, we had to hand format disks by mattmatt · · Score: 1

      01000100 01100001 01101101 01101110 00100000 01101001 01110100 00101100 00100000 01110011 01101111 01101101 01100101 01100010 01101111 01100100 01111001 00100000 01101101 01101111 01100100 00100000 01110100 01101000 01101001 01110011 00100000 01100111 01110101 01111001 00100000 01110101 01110000 00100001

    40. Re:In my day, we had to hand format disks by dw604 · · Score: 1

      Aww, I was hoping for some secret phrase...

      http://www.theskull.com/javascript/ascii-binary.html

    41. Re:In my day, we had to hand format disks by Oktober+Sunset · · Score: 1

      you had teeth? When I was young we had to have all our teeth pulled out to sell to rich folk like you!

    42. Re:In my day, we had to hand format disks by clone53421 · · Score: 1

      01001001 00100000 01110111 01110010 01101111 01110100 01100101 00100000 01101101 01111001 00100000 01101111 01110111 01101110 00100000 01100010 01101001 01101110 01100001 01110010 01111001 00101101 01110100 01101111 00101101 01100001 01110011 01100011 01101001 01101001 00100000 01110100 01110010 01100001 01101110 01110011 01101100 01100001 01110100 01101111 01110010 00101100 00100000 01111001 01101111 01110101 00100000 01101001 01101110 01110011 01100101 01101110 01110011 01101001 01110100 01101001 01110110 01100101 00100000 01100011 01101100 01101111 01100100 00100001

      --
      Alexander Peter Kristopeit bought his basement from his mommy for one dollar.
    43. Re:In my day, we had to hand format disks by clone53421 · · Score: 1

      I think you're looking for
      javascript:void(document.body.style.textTransform="uppercase");

      --
      Alexander Peter Kristopeit bought his basement from his mommy for one dollar.
    44. Re:In my day, we had to hand format disks by Anonymous Coward · · Score: 0

      Hey, we have strap-ons now, you insensitive clod!

      Maybe I should try my strap-on on your ass, to teach you a lesson! :P

    45. Re:In my day, we had to hand format disks by Anonymous Coward · · Score: 0

      American women maybe. But who wants fat or plastic-fantastic extremists anyway? ;)

      Here in Europe, most girls don't mind, and talk "dirty" themselves... Except to people that they are in no way attracted to.

      Hey, maybe that's your problem. :))

    46. Re:In my day, we had to hand format disks by YourExperiment · · Score: 1

      YOU HAD LOWER CASE CHARACTERS?

      (Sigh. Good job we didn't have lameness filters in my day.)

    47. Re:In my day, we had to hand format disks by richie2000 · · Score: 1

      that was all we had as the upper classes would not let us play with the upper case characters

      --
      Money for nothing, pix for free
    48. Re:In my day, we had to hand format disks by Agripa · · Score: 1

      Paper tape? Eee, tha' were lucky. In my day we had to toggle the loader in on front panel switches.

      That is what we had to do to load the paper tape.

      The first programming language I learned was 8080 machine code programmed using a ProLog PROM programmer. My assembler was a pad of paper and pencil.

    49. Re:In my day, we had to hand format disks by morgan_greywolf · · Score: 1

      You had pad of paper? You're lucky. We couldn't afford a whole pad, so we had to make do with like 2 sheets. You either wrote really small, or your erased your old code and rewrote it. Unfortunately, we used the same pencil to punch our paper tape...

    50. Re:In my day, we had to hand format disks by aneurysm36 · · Score: 1

      01100010 01100101 00100000 01110011 01110101 01110010 01100101 00100000 01110100 01101111
      00100000 01100100 01110010 01101001 01101110 01101011 00100000 01111001 01101111 01110101
      01110010 00100000 01101111 01110110 01100001 01101100 01110100 01101001 01101110 01100101

      son of a bitch!

      --
      ------ hi mom
  4. Where the fuck is the download link? by Anonymous Coward · · Score: 0

    n/t

    1. Re:Where the fuck is the download link? by Zonk+(troll) · · Score: -1, Troll

      n/t

      Here.

      --
      "The Federal Reserve is a fraudulent system."--Lew Rockwell
      End The FED. -
    2. Re:Where the fuck is the download link? by Anonymous Coward · · Score: 0

      i'm all for shock links, but for shits sake, i'm at work. a short 'nsfw' would be nice.

    3. Re:Where the fuck is the download link? by Anonymous Coward · · Score: 0

      i'm all for shock links, but for shits sake, i'm at work. a short 'nsfw' would be nice.

      I was too scared to click- what was it? The end of that Jerry Seinfeld Microsoft advert where Bill G wiggles his backside?

      *shudder*

    4. Re:Where the fuck is the download link? by Anonymous Coward · · Score: 0

      Back in my day, we didn't have fancy pictures to goatse people with - we had to stretch out our own assholes! Now get off my lawn you damn spoiled brats!

      --Sen. John McCain

  5. Prior Art! by localman57 · · Score: 5, Interesting

    Wonder how many patents this potentially invalidates?

  6. Not really that hard... by TBadiuk · · Score: 5, Informative

    (wow...my first slashdot post in like 5+ years...something I actually can know stuff about! LOL)

    I wanted to email Trixter this but couldn't find a contact email.

    It's been now about 25 years but I still have parts of the C64 ROM's memorized. There was a time that I knew pretty much what every byte in the 64k(*) of memory was for cold without needing a reference manual. Having said that:

    This wouldn't have been all that hard to do by somebody who had intimiate knowledge of *both* IBM and C64 formats I'd imagine. First, I doubt it was done 'by hand' as in a manual sector by sector copy. A program would have been written, using a slave-master 2 drive config, to stream from the source drive to the dest. drive using a list ot sectors/tracks and/or using a simple formula to calc where the tracks should go. You simply would pick areas on the C64 side that you would want reserved for the IBM side and vica versa. Knowing both IBM and C64 MFM structures would allow you to pick "safe" areas for both formats.

    Oh, and the directory structure of the C64 did indeed live on track 18. All the other data blocks where chained out as a linked list from the entry in this track.

    All that would have been really needed is:

    #1) Format the disk for IBM and use whatever areas you need via a streamed block by block copy from Src to Dst.
    #2) Noting which tracks are "safe" to use on the C64, simply write a program to format track by track and write the C64 data, streaming again.

    Ingenious, but really not that hard at all...

    (*) Well, more like ~80k with the shadow RAM near the top of the 64k range...

    Ted

    1. Re:Not really that hard... by Nursie · · Score: 3, Informative

      I thought C64 floppy drives were notoriously hard to emulate because the drive was programmable and the disc often contained a program made to read its own content?

      In which case you could pretty much do what you wanted, loader-program location excepted.

    2. Re:Not really that hard... by Sloppy · · Score: 4, Informative

      Knowing both IBM and C64 MFM structures would allow you to pick "safe" areas for both formats.

      Poor choice of words, since the C64 (well, the 1541) didn't even use MFM. ;-)

      These aren't just two different filesystems; we're talking about two different encoding schemes used on the same medium, on a track-by-track basis.

      Not hard? Ok, fine, once you've thought of it, you can do it. Weird and a historical curiosity? You betcha!!

      --
      As copyright owner of this comment, I authorize everyone to defeat any technological measure which limits access to it.
    3. Re:Not really that hard... by multipartmixed · · Score: 2, Informative

      Nit: The 1541's directory structure lived on track 18, not the C64's.

      Track 18 was chosen because it was in the middle. That was the typical way Commodore did it back in the day -- So 4040s, 2031s, 1540s and 1541s had track 18 directories, but 8050s, 8250s, and SFD-1001s had them on track 40.

      No idea where the harddrive dirs were, I couldn't afford one.

      --

      Do daemons dream of electric sleep()?
    4. Re:Not really that hard... by Anonymous Coward · · Score: 0

      Knowing both IBM and C64 MFM structures would allow you to pick "safe" areas for both formats.

      What does MFM decode to here? It can't be Modified Frequency Modulation because only the IBM half of the floppy uses that to encode its bits, the C64 half uses GCR and both parts are completely unreadable on the other drive - you couldn't read or write even a single bit in the "wrong" sectors/tracks without reformatting them to the proper coding scheme.

    5. Re:Not really that hard... by TBadiuk · · Score: 5, Interesting

      That was the case for heavy-duty copy protection schemes. The idea was that you'd have a small area of the drive with a loader program in the "normal" format and track 18-0 as readable as well so you could do the directory, the rest in your own non-standard format the couldn't be read at all. You'd then do all sorts of wacky code tricks to obscute the loader program itself, but once it loaded, it could deal with the non-standard data blocks/tracks on the disk.

      Ted

    6. Re:Not really that hard... by TBadiuk · · Score: 5, Informative

      Oops- forgot to add, of course if you didn't do copy-protection at the disk level (as I'm guessing the case is here, hard enough to make it dual format!), this wasn't an issue. You just interwove the data so neither side (C64/IBM) really knew about the other, or cared really. If it wasn't linked via an entry in track 18 the C64/1541 had no business "looking" at a track/block). Not sure what the deal was on the IBM side but I'd guess simular.

      Ted

    7. Re:Not really that hard... by Anonymous Coward · · Score: 2, Funny

      >It's been now about 25 years but I still have parts of the C64 ROM's memorized.
      >There was a time that I knew pretty much what every byte in the 64k(*) of memory was for cold without needing a reference manual.

      I have SYS 64738 that part of my memory a long time ago.

    8. Re:Not really that hard... by TBadiuk · · Score: 5, Interesting

      Actually, I butchered a few terms in my post most likely. My brain nearly froze trying to remember the different terminologies (block/sector etc) from back in the day! I haven't done low level disk stuff on any platform since the late 80's. I think I got the meaning across OK hopefully.

      Also- I think the encoding was more likely at a lower level then even what you'd consider "track basis". I don't really know the IBM side so I don't know if the interleave would have been same, etc. Again I can visualize what I mean here, but I can't remember the terms anymore for what the "lead in", "gap" etc in the low level bit encoding was called. I think I've blocked out all the programming knowledge I used to have regarding getting the 1541 to do it's voodoo (*shudder*, assembly from hell!).

      Ted

    9. Re:Not really that hard... by TBadiuk · · Score: 1

      I could have sworn I saw all the bits on my LCD all shift over about 0.25" for a second, then go to normal as read that! LOL

      Ted

    10. Re:Not really that hard... by TBadiuk · · Score: 1

      GCR - Thank you! That's the acronym I meant! I've been brainwashed by the PC world it seems, whenever I think :bit level media encoding" the letters "MFM" immediately jumps to mind these days...:-(

      As for getting them to play nice with each other - just set up the directory so that the C64 has no business ever "looking at" a IBM section (and vica versa). In this case, the entries (files) in track 18 just need to point to only the "good" C64 blocks. The C64/1541 never touched (well,read) any block unless it was in a files chained pointer list. Also, I believe (bit fuzzy here) you have a "free block table" so you could have even marked off all the other areas so you could write to the IBM portions. Well, at least not through the normal SAVE command anyway (ie- mark the disk as full, 0 blocks free).

      Ted

    11. Re:Not really that hard... by snarfies · · Score: 1

      The C64's 5.25 drives (1541, 1571) didn't use MFM - they used GCR. Only their 3.5 drives (1581) used MFM.

    12. Re:Not really that hard... by multipartmixed · · Score: 1

      No. The 1571 could do either GCR or MFM. MFM support was added so that CP/M programs from Osbourne, Kaypro, Epson and IBM could be read on the C=128.

      --

      Do daemons dream of electric sleep()?
    13. Re:Not really that hard... by Anonymous Coward · · Score: 0

      (wow...my first slashdot post in like 5+ years...something I actually can know stuff about! LOL)

      This is actually not a requirement any longer to post here. Not for posters, editors, or even submitters! And if you get caught telling a fib, you can just say that you heard this from your girlfriend in Canada. :)

    14. Re:Not really that hard... by MBGMorden · · Score: 1

      It's been now about 25 years but I still have parts of the C64 ROM's memorized. There was a time that I knew pretty much what every byte in the 64k(*) of memory was for cold without needing a reference manual. Having said that:

      Neo: Do you always look at it in code form?
      Cipher: Well, you have to. The viewer works for the Ti-99/4a, but there's way too much information to decode the C64.

      --
      "People who think they know everything are very annoying to those of us who do."-Mark Twain
    15. Re:Not really that hard... by snarfies · · Score: 1

      I stand corrected, but I very much doubt that this game was written for use only on a 1571 drive - the majority of Commodore owners had a 1541.

    16. Re:Not really that hard... by nEoN+nOoDlE · · Score: 1

      You forgot "Now get off my lawn!"

      --
      Don't trust a bull's horn, a doberman's tooth, a runaway horse or me.
    17. Re:Not really that hard... by mattack2 · · Score: 1

      Do you mean that there is a file on the IBM side 'taking up' the space for the C64 side, and vice versa? If so, couldn't you (or someone else) hose the disk by trying to delete that file "to make more space"? Though maybe these weren't even MSDOS disks, and thus had a completely custom filesystem, like lots of software back then.

    18. Re:Not really that hard... by jonadab · · Score: 2, Interesting

      > Not sure what the deal was on the IBM side but I'd guess simular.

      Assuming FAT12, you just mark it as used in the allocation table but don't make any directory entry point to it. As long as nobody runs filesystem-checking software on it (along the lines of scandisk, but scandisk itself didn't exist back then, so it'd be a third-party utility), there shouldn't be a problem. And a game disk is probably meant to be read-only, in which case nobody has any business running filesystem checks on it.

      This is assuming that the two formats don't both need certain specific sectors. In the case of FAT12, I *think* certain things have to go at the beginning of the disk (low-numbered sectors), but it's been a good while since I did any significant low-level filesystem fiddling, so I could be remembering that kind of detail incorrectly.

      --
      Cut that out, or I will ship you to Norilsk in a box.
    19. Re:Not really that hard... by Trixter · · Score: 1

      Ingenious, but really not that hard at all...

      Which is precisely the part that blew my mind :-)

    20. Re:Not really that hard... by TBadiuk · · Score: 2, Informative

      My inital post wasn't really specific enough in it's terminolgy. It was almost painful to bang out as I was dealing with some pretty old memories! :p

      When I said "side" I should have really said something like "from the view of the (C64/IBM)". I wasn't really talking about sides of the disk, but the 'view' you take when working on one system or the other.

      For the actual physical layout, it looks like one side of the floppy itself was used in it's entirity for the IBM data. The other side of the floppy had interwoven C64 and IBM data. On the hybrid side the 'free block table' (there is an "proper" name for this I cannot remember) was filled so all sectors were marked as in-use, the file marked as no-delete, etc was done.

      Also - the disks themselves had those little notches that had to be present (physical write-protection) else you couldn't modify the contents at all anyway. This was probably the case for this diskette (or would have been if it went into production).

      Ted

    21. Re:Not really that hard... by sjames · · Score: 1

      That was part of it. The 1541 drives had a 6502 and their own ROM.

      Another part is that the disk was divided into concentric zones with different data rates to squeeze a bit more capacity out of the outer tracks.

    22. Re:Not really that hard... by sjames · · Score: 1

      It might have been interesting getting the IBM and C64 drive's idea of where a track goes to line up close enough. The floppy was just a disk of magnetic media with no intrinsic tracks on it. The drive decided where those were.

      It could also have gone wrong because the two formats (and physical characteristics of the mechanisms) are designed not to interfere with adjacent tracks in the same format. They just happened to be able to work with the interleaved formats.

      Like many really great ideas, it's really simple in retrospect.

    23. Re:Not really that hard... by sjames · · Score: 1

      At least on the IBM side, the FAT had the C64 tracks marked as full of "BAD" sectors. Without a sector editor or similar tool, there was no way to get it to even try to access those sectors.

      Back in the day, both floppies and HDs commonly had sectors marked as bad. Part of the formatting process was verifying all of the sectors and marking the ones that failed as bad. More modern HDs hide the imperfections internally by remapping to spare sectors instead. The filesystem is presented the illusion of perfect media.

      I don't recall if the C64 had a similar mechanism, I probably knew at one time.

      In any event, being install media, it would have been write protected anyway. Once you decide to re-enable writing, you can hose both filesystems freely. Of course, a bulk eraser could also do that, but why would you want to screw with the install media?

    24. Re:Not really that hard... by Anonymous Coward · · Score: 0

      Ted, the disc was not full MFM, but MFM for the PC floppy tracks, and that other C64 bit encoding format for the C64 tracks.

      Yes, you could do it using two C64 floppy drivers or a any-type hardware disc duplicator (I have seen a few, it doesn't even have a CPU, just a few state machines and counters, and a physical assembly that made sure you were writing discs at the exact position you read something from the master).

    25. Re:Not really that hard... by operagost · · Score: 1

      Liar... you last posted about MS moving its R&D to Canada on Thursday, July 05, 2007. :-P

      --

      Gamingmuseum.com: Give your 3D accelerator a rest.
    26. Re:Not really that hard... by TBadiuk · · Score: 1

      LOL - Yeah, I forgot about that one! That was the first one since 2001 though. We need more C64 threads, then I'll be able to post more! :-)

      Ted

    27. Re:Not really that hard... by thogard · · Score: 1

      Even easier...
      You just tell it that its a 16 track disk and don't even format the rest. The PC uses the 1st track and the C64 uses 18 on.
      The PC uses 512 byte sectors while TRS-80 used 256 byte sectors. They TRS80 and IBM PC both used nearly the same controller chip and the
      Apple ][, V20/c64 did the decoding in software.
      There were disks that worked with both the COCO (also used track 18 for dir) and Microware's OS9.

    28. Re:Not really that hard... by Anonymous Coward · · Score: 0

      Given that Avantage was the publisher, the protection on it likely would've been Rapidlok which is one of the most devious ones in the C64 world. That the disk was dual format doesn't surprise me in the least.

    29. Re:Not really that hard... by Hal_Porter · · Score: 1

      Assuming FAT12, you just mark it as used in the allocation table but don't make any directory entry point to it. As long as nobody runs filesystem-checking software on it (along the lines of scandisk, but scandisk itself didn't exist back then, so it'd be a third-party utility), there shouldn't be a problem.

      If you mark the sectors you want to hide as bad, chkdsk which did exist them will ignore them.

      --
      echo -e 'global _start\n _start:\n mov eax, 2\n int 80h\n jmp _start' > a.asm; nasm a.asm -f elf; ld a.o -o a;
  7. GNAA by Anonymous Coward · · Score: -1, Troll
  8. I seem to recall that there were others like this. by Anonymous Coward · · Score: 0

    Back in my Atari days, I seem to recall there being some games that had Atari and C64 versions on the same side of a disk even though the two formats were incompatible. Couldn't tell you which ones anymore, though.

  9. There were a few hybrid formats around in the 80s by FromellaSlob · · Score: 5, Interesting

    This does look like a very early example, but the technique is not as novel and amazing as the article makes out.

    For example, in the UK around 1989 there was a magazine for Atari ST and Amiga users called "ST/Amiga Format" that used a hybrid format on 3.5" coverdisks. The ST used a PC-like 720MB format, whereas the Amiga had its own filesystem that fitted 880MB on the same disk. The hybrid disks weren't flippable, they were read double-sided on both systems and just marked the part of the disk used for the other filesystem as bad.

  10. ST/Amiga Format by Ford+Prefect · · Score: 5, Informative

    The short-lived, dual-format ST/Amiga Format magazine from the late 1980s also had an appropriately dual-format cover-disk - somehow combining the apparently wildly-incompatible ST and Amiga floppy disk formats.

    I've no idea how it was done (although the fact that many STs had single-sided floppy drives may have had something to do with it) - and while it could have been extremely useful to publish games in such a manner at the time, I don't know that was ever done either.

    I get the impression that there was a lot of deep magic involved in these enhanced disk formats, copy protection systems and so on. I'm sure the name Rob Northen appeared on the front of a later ST Format cover disk - as the supplier of the fancy files-limited-to-particular-sides-of-disk format used to not deprive single-sided drive owners the contents of the entire double-sided disk...

    --
    Tedious Bloggy Stuff - hooray?
    1. Re:ST/Amiga Format by Anonymous Coward · · Score: 0

      The Amiga could simply read the ST diskettes. It was a very flexible diskette drive. Computer clubs of the day would line up their Amigas running xcopy in nibble mode, and copy software for all sorts of other platforms. You'd get ST fanboys telling everyone how crap the Amiga was while it was copying their games for them.

    2. Re:ST/Amiga Format by digitalhermit · · Score: 1

      The amazing little floppy.. hehe..

      Speaking of drives, do you recall the SpectreGCR and the Twister format? One of the Elders at the time (Dave Small) had written a program that re-worked the track/sector format. It skewed the sectors on the the disk so that as the read head moved from track to track it was quicker to get to the next sector number... The Spectre GCR was a hardware device that allowed the Atari ST drives to read the Macintosh disk format.

      There was no difference, iirc, between an ST and MS-DOS disk except for some filesystem information. So MS-DOS disks could be read with the appropriate software.

    3. Re:ST/Amiga Format by Anonymous Coward · · Score: 0

      Yup, Rob Northen was single-handedly responsible for ST/Amiga Format's coverdisk, and a good 80% of most of the other exotic copy-protections on the ST and Amiga. My own Syncro Express (an early, somewhat dodgy, Datel Designs bona fide hardware hack), Knife-ST and MonSTer was probably responsible for copying quite a few of them, too. ;-)

      I particularly enjoyed Wayne Smithson's "Anarchy", which was filled from beginning to end with amusing messages and dares from Rob, from the bootsector onwards, as the format got ever more exotic (the game itself was no more than 100K - the rest of the disk was essentially filled with hidden messages that the game didn't even need and Rob apparently had put there entirely for shits and giggles).

      I remember when the two magazines split, too, quite largely because of the increasing (legendary) rivalry between the Amiga and ST.

      I remember ST Format Cover Disk #1 (with the Bloodwych demo on), too. Not all STs had double-sided drives, and it interleaved each track per side on a double-sided format by default so a single-sided drive couldn't read a double-sided disk at all. So Rob came up with a simple solution; a single-sided format on each side, and a program if you had a double-sided drive that literally swapped the data on sides 1 and 2, essentially flipping the disk for you (which was impossible by hand in a 3.5" floppy without surgery, of course!). The later ones were, indeed, cleverer, and simply allocated all the files and structures onto every other track and formatted the FAT especially so that everything inside the SIDE_2 folder was, in actual fact, on side 2, and you could read the disk fine in a single-sided drive, no daring side-swapping program necessary.

      After a while, they didn't bother and just assumed that anyone who still had a single-sided drive in their STF/STFM would have had to get an external double-sided drive because it'd probably conked out by the 3-year mark. :-)

      Ah, memories... what have we got now? Weak sectors? Twin sectors? Twin-seek time measurement? Lame-ass rootkits with interpreted self-modifying bytecode callouts? There's nothing new under the sun, but they sure don't make 'em like they used to.

      Part of me's glad of that, too. Over twenty years, and more people are copying games than ever before, and the copy protection is still on occasion so awful it encourages people to get the protection-free, 100% working crack. You'd think more of the industry would have learned that they seemed to have survived all that piracy OK to be as big as the movies, so why worry?! :-)

    4. Re:ST/Amiga Format by Chris+Pimlott · · Score: 1

      One of the Elders at the time (Dave Small) had written a program that re-worked the track/sector format. It skewed the sectors on the the disk so that as the read head moved from track to track it was quicker to get to the next sector number...

      I remember non-standard DOS formatters that used that trick, and others that managed to squeeze a few hundred more K out of the standard 1.44mb floppy.

    5. Re:ST/Amiga Format by __aajfby9338 · · Score: 3, Informative

      To be pedantic, the Amiga had a very flexible diskette drive controller. The drives themselves were essentially the same as drives used in PC clones, aside from having a diskette presence detect switch which was generally omitted in PC drives. As I recall, PC drives (even 5-1/4" ones) could be plugged into the Amiga and used, but the computer wouldn't automatically notice diskette insertions because of the missing switch. The Amiga used odd-ball 23-pin D-sub connectors for the disk drive, but they could be made out of DB-25 connectors with a Dremel tool.

      The Amiga stored 880K (IIRC) on a 720K disk because it simply crammed more sectors on each track. The PC's controller would write a sector at a time, so its disk format required gaps between the sectors to allow it to write a sector without stomping on either of the adjacent sectors. The Amiga's diskette drive controller could write an entire track in one pass, so the Amiga format could dispense with both large inter-sector gaps and sector interleaving. The Amiga could also read and write PC disks (with appropriate software that bypassed the regular filesystem code), by simply programming the diskette controller to put fewer sectors on each track and place them farther apart.

      Some folks liked to use nonstandard formats which crammed even more data on the diskette by using more than 80 tracks. Many diskette drives of the day were capable of stepping the head out beyond track 80, but how many tracks would vary from drive to drive. Thus, these nonstandard diskette formats weren't as portable as the normally-formatted ones, since hacker A might be able to write one or two more tracks on their diskette drive than hacker B's drive could handle.

      Now, I think that the Macintosh drives of that era were physically different somehow, but I don't remember the details. I vaguely recall that there was a product that allowed the Amiga to emulate a Macintosh, and it had some sort of electronic doohickey that installed between the computer and the diskette drive to let the Amiga read/write Macintosh diskettes. Or maybe it required a completely different diskette drive... my memory is fuzzy.

      This conversation does bring back memories, though! I remember having a flaky diskette drive and being too poor to either replace it or have it fixed by a pro, so I had to do a ham-fisted re-alignment by loosening the stepper motor and turning it by hand until it read some random disk semi-reliably! Hmm, I think I even did that in the snake-infested snow, uphill in both directions. :-)

    6. Re:ST/Amiga Format by sandman_eh · · Score: 1
      Sector skew was a standard parameter on 5 1/2 " and 8 " drive systems. It had almost disappeared by the time I saw 3 1/2" floppies. I'm sure it still exists in hdd media, but that below the layer that is exposed outside the device these days.

      The idea is , skew the sectors around the disc by an amount equivalent to how far the disc rotates during stepping - so the next sector (eg 0 - as this was a consecutive read optimisation) was arriving under the read head just as the drive started to search for sector 0.

      But the first floppy format routine I had, sector skew was a command line parameter (or similiar). Different drives and different stop characterstics - I remember having to program the defaults in.

      --
      Master of Peng Shui.Ancient oriental art of Penguin Arranging)
    7. Re:ST/Amiga Format by romanval · · Score: 1

      The Mac 400/800K 3.5" floppies had a variable speed spindle that would slow down the disk rotation as the read/write head went towards the outer tracks. This made the disks hold a bit more data as the track density would be more even across the disk...

      The problem is this made the disks really difficult to read on non-apple drives... I'm not sure how they fixed it on the original Apple Superdrive (1.44Mb HD floppies)... it probably involved a special read controller rather then a variable speed spindle.

      Even to this day a USB floppy drive on a Mac can't read those 400/800K disks.

    8. Re:ST/Amiga Format by __aajfby9338 · · Score: 1

      Oh, yeah! That sounds familiar now that you mention it. I don't remember how this was worked around with the Macintosh emulator on the Amiga back then, but I'm pretty sure that there was some way to read and write the Macintosh diskettes.

    9. Re:ST/Amiga Format by thogard · · Score: 1

      The hardware based controllers (TRS and PC) had a sensor to look for the hole. That was only used for formatting because you just told the chip what sector you were trying to read and it collected it for you as the disk went around. The formatting could allow 218, 256 or 512 byte sectors (or even other sizes too) and there were a great deal of wasted space between the sectors. When I was playing with 80 track double sided disks, I found I could get massive capacities if I was willing to rewrite the entire track every time I wanted to write one sector by simply not putting as much junk in between each sector. Once you start writing a track at a time, you look for the hole and start writing and hope the hole doesn't show up before your done. The sector order didn't matter.

    10. Re:ST/Amiga Format by Anonymous Coward · · Score: 0

      The macs used GCR and so could fit slightly more data bits per physical bit on the disk. The Amiga could do GCR without modification, which would give slightly larger disk capacity.

  11. Just more corruption on the 8088 ... by DigitalDreg · · Score: 2, Funny

    It's just another case of corruption on an 8088 ;-)

    (If you know Trixter, then you know what I'm talking about ... http://www.oldskool.org/pc/8088_Corruption )

  12. Interesting by AndGodSed · · Score: 0, Redundant

    What tickles me is the "hand-formatted" part. How was that done?

    well... off to rtfa....

    1. Re:Interesting by Yvan256 · · Score: 1

      Answer: with a magnetized needle and a very steady hand.

      Next question?

    2. Re:Interesting by Amouth · · Score: 1

      it was done with butterflies

      http://xkcd.com/378/

      --
      '...if only "Jumping to a Conclusion" was an event in the Olympics.'
  13. OB: XKCD by Anonymous Coward · · Score: 0, Funny

    Pussy. I use butterflies.

    http://xkcd.com/378/

    1. Re:OB: XKCD by zippthorne · · Score: 2, Funny

      Pfft. Real programmers just think really hard, choosing the proper universe such that electrons happen to tunnel at just the right place and time to affect the magnetizer.

      Even better ones choose the universe in which the atoms of the proper hard disk spontaneously tunnel into just the right configuration from across spacetime.

      --
      Can you be Even More Awesome?!
    2. Re:OB: XKCD by rickb928 · · Score: 1

      Butterflies?

      We considered that, but waiting for evolution to process butterflies wasn't an option. We went with Daleks. Time Lords were busy...

      Or course, the Daleks caused more trouble than they solved. We shoulda waited for the butterflies after all. Let that be a warning to you .NET types. Don't glom onto the most insanely great thing just cause it's pretty, louder, or has a bigger gun, ok?

      --
      deleting the extra space after periods so i can stay relevant, yeah.
    3. Re:OB: XKCD by Ambiguous+Puzuma · · Score: 1

      What is magic?
      Then there is the witches' explanation, which comes in two forms, depending on the age of the witch. Older witches hardly put words to it at all, but may suspect in their hearts that the universe really doesn't know what the hell is going on and consists of a zillion trillion billion possibilities, and could become any one of them if a trained mind rigid with quantum certainty was inserted in the crack and /twisted/; that, if you really had to make someone's hat explode, all you needed to do was /twist/ into that universe where a large number of hat molecules all decide at the same time to bounce off in different directions.
      Younger witches, on the other hand, talk about it all the time and believe it involves crystals, mystic forces, and dancing about without yer drawers on.
      Everyone may be right, all at the same time. That's the thing about quantum.
      --Terry Pratchett, "Lords and Ladies"

      Pfft. Real programmers just think really hard, choosing the proper universe such that electrons happen to tunnel at just the right place and time to affect the magnetizer.

      Even better ones choose the universe in which the atoms of the proper hard disk spontaneously tunnel into just the right configuration from across spacetime.

      So, a Real Programmer is...a witch!

    4. Re:OB: XKCD by Ortega-Starfire · · Score: 1

      Daleks might seem bad, but my company decided to invest in Quarian Geth for outsource coding. I'd take Daleks over how THAT fiasco turned out any day.

      --
      ---- Liquid was a patriot ----
    5. Re:OB: XKCD by rickb928 · · Score: 1

      Bah (waving paw at you)...

      A Myrdmonic Carbonizer would have kept the Geth in check. Then just take the keys to the Winnebago. Like little puppies...

      --
      deleting the extra space after periods so i can stay relevant, yeah.
  14. I thought something different... by iCeSkUuBe · · Score: 1, Funny

    I clicked on the story thinking he had found some kind of strange Goatse image embedded in the disk. I was very disappointed.

    1. Re:I thought something different... by HTH+NE1 · · Score: 2, Funny

      I clicked on the story thinking he had found some kind of strange Goatse image embedded in the disk. I was very disappointed.

      Thank you for that. I'll never be able to look at the spindle hole of an 8" or 5.25" disk the same way again.

      --
      Oh, say does that Star-Spangled Banner entwine / The myrtle of Venus with Bacchus's vine?
  15. Floppy Records! by qwertphobia · · Score: 5, Interesting

    For some reason it reminds me of the floppy records that came inside magazines, when I was a kid. We would transfer the audio from the record to a cassette, then load the cassette into the computer.

    Nobody even whispered, because we were convinced the least bit of sound would get mixed in and corrupted the whole thing. Same goes for acoustic-couple modems, except it really worked that way sometimes. Too much background noise and you'd lose carrier.

    Ahhh.. the good old days.

    --
    Never ask for directions from a two-headed tourist! -Big Bird
    1. Re:Floppy Records! by British · · Score: 1

      I have a 45 single from a new wave band(MainFrame). The B-side doesn't contain a song, but a program, in 3 different versions for some UK computers. Pretty slick. There's a whole web page devoted to cassette programs stuck on Vinyl. I think even The Stranglers did it on a release.

    2. Re:Floppy Records! by thermian · · Score: 1

      I have a cassette of spectrum games, and the accompanying book in a plastic case, from a magazine in 1984. PC Format I believe, the box isn't to hand right now.

      The magazine is still around, I keep wondering if I should post it to them.

      --
      A learning experience is one of those things that say, 'You know that thing you just did? Don't do that.' - D. Adams
    3. Re:Floppy Records! by prockcore · · Score: 1

      I had a tape for some band that had modem noise on the b-side. It was a kermit transfer of the lyrics.

  16. Re:There were a few hybrid formats around in the 8 by Anonymous Coward · · Score: 0

    1989... 720MB format... 880MB...

    WOW

  17. Anyone remember audio+data CDs? by davidwr · · Score: 1

    At a trade show in the '80s someone had a Macintosh CD that had audio tracks following. There was nothing magical about this, it was part of the standard.

    But it was uncommon. Maybe people didn't like getting random noise when they played the first track in their audio cd player.

    --
    Knowledge is how to play a game, intelligence is how to win, wisdom is knowing what game to play.
    1. Re:Anyone remember audio+data CDs? by Nursie · · Score: 1

      Umm, they're still quite common. Lots of music is put out with extra stuff (video or DRM) on data tracks at the end. Usually this uses the CD extra format which puts data at the end in a separate (but linked) session.

      The CDROM + audio thing has audio starting with track 2 and is good , but not quite as good because if you put it into a CD player it'll try to play the first track as music and make bad noises.

    2. Re:Anyone remember audio+data CDs? by Penguinoflight · · Score: 1

      It really wasn't that uncommon, Microsoft studios did the same thing in the late 1990s with Outwars and the original Age of Empires as well as the expansion pack. Earlier games used this technique to allow for less cpu overhead while playing music, typically the sound was just sent though the cd-in connector.

      --
      "And we have seen and do testify that the Father sent the Son to be the Savior of the World"
      1 John 4:14
    3. Re:Anyone remember audio+data CDs? by W.+Justice+Black · · Score: 1

      You used to see this a lot on computer games--one track with code, the others with background music. The game would load and then just tell the audio bits of the CD player to play the BGM tracks. This kept the CPU from having to deal with BGM, and you get CD-quality audio...

      --
      "Time flies like an arrow; fruit flies like a banana." --Groucho Marx
    4. Re:Anyone remember audio+data CDs? by drakono · · Score: 1

      Not that uncommon. I remember playing the background music from many of my game discs in a CD player.

    5. Re:Anyone remember audio+data CDs? by Stoutlimb · · Score: 1

      The grandparent poster must not be used to store bought music media. I sure haven't used any of that obsolete stuff since I discovered mp3's in the 90's. His unfamiliarity with that old format is perfectly understandable.

    6. Re:Anyone remember audio+data CDs? by Tawnos · · Score: 1

      Quake 2 and Half Life both had excellent soundtracks to listen to independent of the game.

    7. Re:Anyone remember audio+data CDs? by WK2 · · Score: 3, Insightful

      This is a somewhat common attack vector for Windows. A malware author creates a data/audio CD and then distributes it as an audio CD. If the victim puts it in their CD player, it plays fine*. If they put it into their Linux machine, and then play it like an audio CD it plays fine. But when they put it into their Windows machine, Windows (by default) recognizes the CD as data, and then loads the autorun program, which is a trojan horse.

      Sony's rootkit a few years ago did exactly this.

      * Some people here are saying that a CD player will attempt to play the data track as audio, and it will be random noise. I have never experienced this from data/audio CDs.

      --
      Write your own Choose Your Own Adventure. http://www.freegameengines.org/gamebook-engine/
    8. Re:Anyone remember audio+data CDs? by flahwho · · Score: 1

      Much of that lead to mixed mode and enhanced CD's that would not only contain Audio tracks but extended data for a PC or MAC

      One of the coolest enhanced CD's (and quite possibly the first popular was soundgardens Alive in the Superunknown. out in 95 this was the shit!

    9. Re:Anyone remember audio+data CDs? by sanosuke001 · · Score: 1

      If you try to put the data on the same partition you can "play" the data track. Though, you're supposed to make the audio cd in session 1, close the session (not the disc) and then put the data in session 2. The audio cd player will only access session 1 (for this purpose) and won't/can't "play" the data on session 2.

      --
      -SaNo
    10. Re:Anyone remember audio+data CDs? by m50d · · Score: 1

      * Some people here are saying that a CD player will attempt to play the data track as audio, and it will be random noise. I have never experienced this from data/audio CDs.* Some people here are saying that a CD player will attempt to play the data track as audio, and it will be random noise. I have never experienced this from data/audio CDs.

      If you *just* do what you said, that's exactly what will happen. Most CDs of this sort do an additional step: they're created in multisession form, with the first session containing only the audio tracks and the second both the audio and data. Then audio CD players only read the first session and so only see the audio tracks, while computers read all the sessions and can handle both audio and data tracks appropriately. You'll occasionally find an audio CD player which uses a computer drive (it's apparrently more common in car players?), which will get confused by such CDs.

      --
      I am trolling
    11. Re:Anyone remember audio+data CDs? by petermgreen · · Score: 1

      Some people here are saying that a CD player will attempt to play the data track as audio, and it will be random noise. I have never experienced this from data/audio CDs.
      Afiact there are two main ways to make a combined data/audio CD.

      The first which was generally used by games that used CD audio (games gave up on using CD audio as computer hardware improved and CD space became more valuable) is to put everything in one session with the data track first and the audio tracks following. This had the advantage of compatibility with all CD rom drives but the disadvantage that many audio players would attempt to play the data track.

      The second which is generally used for extra content (or occasionally DRM enforcers) on audio CDs is to put the audio in the first session and the data in a second session. This means that audio players don't see the data at all but it means the data can only be read if the drive supports multisession (all modern drives do but some early drives didn't).

      --
      note: i'm known as plugwash most places but i screwd up registering that here somehow in the past and now can't register
    12. Re:Anyone remember audio+data CDs? by Nursie · · Score: 1

      Fair enough, it's likely a generational thing - I'm 30 and I shouldn't be old enough to say that though.

      I buy CDs, rip them and then file 'em away, using various computers and portable players to listen to them. I think that's what most of my friends do too.

      I wouldn't call CDs obsolete, I'd call them a good archive format, though these days quite a bulky one.

    13. Re:Anyone remember audio+data CDs? by beaviz · · Score: 1

      Some people here are saying that a CD player will attempt to play the data track as audio, and it will be random noise. I have never experienced this from data/audio CDs.

      You have to buy an older CD player ;)

      The Philips CD-100 - one of the first players - will happily play anything you put into it.

    14. Re:Anyone remember audio+data CDs? by Anonymous Coward · · Score: 0

      >>* Some people here are saying that a CD player will attempt to play the data track as audio, and it will be random noise. I have never experienced this from data/audio CDs.

      Very Early Audio CD drives would attempt to play the Data track(s) as Audio. As this could damage speakers (Max Volume in sharp spikes) and was quite annoying, the drive Manufacturers added logic to skip data tracks. Thus allowing for such shennaigains as the Sony root kit(1) and the like.
          You have to get a hold of a very early drive to run into this. By the time the price of drives and CD's had dropped into the Mass market range this didn't happen any more.

      (1) This is why Autoplay (windows/mac/linux/os of your choice) is a Bad Idea(TM).

  18. Yawn..... by jag7720 · · Score: -1, Troll

    Yawn.....

    1. Re:Yawn..... by poopdeville · · Score: 2, Insightful

      Seriously. If somebody did this today, it would be featured on the daily wtf.

      --
      After all, I am strangely colored.
  19. Probably the coolest thing ever! by Bananenrepublik · · Score: 5, Informative

    This is a cool hack. From what it looks like, this is possible because DOS put the boot sector and the root directory in the beginning of the disk, whereas the C64 made the sane choice of putting it in the middle (think about it, this minimizes seek times). Now the directory (or, more precisely, the File Allocation Table (=FAT)) contains information on so-called bad blocks, i.e. blocks that the OS shouldn't write to because they were known to be bad. If you label the blocks that you put the C64 data into as bad blocks, then DOS is not going to overwrite the C64 data. Now you do the same in the C64 FS and bang -- double OS format created. And it's read/write!

    I wonder if someone managed to format a disk such that one was also able to share the data space between the different OSs?

    1. Re:Probably the coolest thing ever! by Carnildo · · Score: 1

      I wonder if someone managed to format a disk such that one was also able to share the data space between the different OSs?

      Not possible. The C64/1541 and the IBM-PC used different encoding schemes for putting the bits on the disk. This is why the C64 tracks needed to be marked as "bad" rather than as "in-use".

      Mac/Windows hybrid CD-ROMs can and do share data, but that's because the underlying on-disk encoding is the same for both.

      --
      "They redundantly repeated themselves over and over again incessantly without end ad infinitum" -- ibid.
    2. Re:Probably the coolest thing ever! by Anonymous Coward · · Score: 0

      I had several 5¼ floppy drives all installed into one system box. I found that each drive copied in different locations on the floppy disk. Delete and reformat all information with one drive and it was gone but the information printed by the other drive would still be there assessable by the drive that printed it.

  20. Not the first "double format" image by Megane · · Score: 3, Interesting

    This one is relatively easy to do, since DOS uses track 0 to find the directory, and the C64 keeps the directory on a middle track. Even better, the whole second side of the disk could be formatted for PC sectors. But you do have to put the disk through two duplicators, one for the PC sectors, and another for the C64 sectors. (Nowadays this could be done with a Catweasel or similar disk controller that deals with times between transitions.)

    This is pretty impressive, but it only needs one format per track. There have been cases where the same track was in multiple formats. The TRS-80 Model I booted from a single-density T0S0, while the Model III booted from a double-density T0S0. There were autoboot games which formatted sectors on track 0 in both single and double density.

    As I heard it, the first part of the trick is that the Model I switched density by having both types of disk controller chips. (I don't know details of how the III did it) The second part of the trick is that you start one of the FDC chips formatting a track, then interrupt it partway through. Then you start the other FDC formatting the rest of the track. Presto, you have a track with sectors in both densities! You don't need any other data on track zero, as the boot sectors were customized to boot from the rest of the disk in single density, which both a M3 and an standard single-density M1 could read.

    --
    #naabhaprzrag, #sverubfr-000, #agi-fcbafberq, negvpyr[pynff*=' negvpyr-ary-'] { qvfcynl: abar !vzcbegnag; }
    1. Re:Not the first "double format" image by HTH+NE1 · · Score: 1

      I also theorized about this as a kid. It's easy when the platforms you want it to work with look at different places for their initial data, and easier if you can direct them to unusual places for subsequent data.

      But if you have two systems with different processors both going to the same track and sector for their first data, it becomes an exercise in how to write machine code that both systems can execute and neither of them crash running. A matter of finding safe bytes that do nothing of consequence on one platform but becomes an unconditional branch case on the other so you can split the boot block in half.

      And as long as your disk is write protected, you don't need to worry about maintaining two sets of sector allocation tables, or even if they overlap each other. To make one of them writable could be done. To do both would require either teaching each OS how to allocate for the other or sync them on reboot.

      Assuming of course there are no Magic Numbers in a common spot to foil any such an attempt, or just completely different formatting methods. E.g. TiVos use a different magic number in their otherwise standard Macintosh partition table to foil trivial access by a Mac to their Ext3 partitions (video is stored in a proprietary filesystem), and earlier models also being byteswapped.

      If I really set myself down to do it, I could probably create a 5.25" disk that would boot into ProDOS on 65c02 and 65c816 Apple II machines and into DOS 3.3 on 6502 Apple II machines.

      --
      Oh, say does that Star-Spangled Banner entwine / The myrtle of Venus with Bacchus's vine?
    2. Re:Not the first "double format" image by clone53421 · · Score: 1

      Incidentally, did you know that "<!-- ", in 80x86 assembly, is CMP AL,21, SUB AX,202D? Gives a new (or should I say old) meaning to ".com"...

      --
      Alexander Peter Kristopeit bought his basement from his mommy for one dollar.
    3. Re:Not the first "double format" image by Hal_Porter · · Score: 1

      I come here for comments like this.

      --
      echo -e 'global _start\n _start:\n mov eax, 2\n int 80h\n jmp _start' > a.asm; nasm a.asm -f elf; ld a.o -o a;
    4. Re:Not the first "double format" image by clone53421 · · Score: 1

      Heh. Yeah, so I created this .htm document (think "hello world!") which, when loaded into debug.exe and executed, prints something entirely different to STDOUT... (and the message also isn't plainly visible in the source, since I used an XOR substitution cypher)

      The real trick was avoiding unprintable ASCII characters in my bytecode. That limits you to 0x09 (Tab) and 0x20-0xFF (spacebar and upward, everything above 0x7E has to be typed using the Alt key of course), since I preferred to avoid CR or LF because of the compatibility issues. You can copy/paste the "View Source" into a text editor, save it with a .com extension, and it will execute in DOS.

      Lately I've been writing assembly in debug. I even wrote a code snippet that dumps bytes from the CS into a .com file so I can "compile" my creations. It's frighteningly geeky (which is probably why I love it).

      --
      Alexander Peter Kristopeit bought his basement from his mommy for one dollar.
    5. Re:Not the first "double format" image by Zwicky · · Score: 1

      Do you blog about this stuff, your processes and revelations? It sounds like it would be a very interesting read.

      My hat is off to you Sir.

      --
      "Three eyes are better than one" -- Lieutenant Columbo
    6. Re:Not the first "double format" image by clone53421 · · Score: 1

      Unfortunately, I don't.

      --
      Alexander Peter Kristopeit bought his basement from his mommy for one dollar.
    7. Re:Not the first "double format" image by Zwicky · · Score: 1

      Maybe you should ;)

      --
      "Three eyes are better than one" -- Lieutenant Columbo
    8. Re:Not the first "double format" image by clone53421 · · Score: 1

      Tell you what... I'll put some stuff in my Journal. Hopefully you're on Windows, or none of it will work.

      --
      Alexander Peter Kristopeit bought his basement from his mommy for one dollar.
  21. Re:There were a few hybrid formats around in the 8 by Yvan256 · · Score: 2, Funny

    Not only that, but on a 3.5" floppy too!

  22. Re:There were a few hybrid formats around in the 8 by FromellaSlob · · Score: 3, Funny

    LOL, ok that KB, not MB.

  23. Maybe... by hwk_br · · Score: 1
    --
    \m/
  24. Atari 800/C64 disks by logicassasin · · Score: 2, Informative

    If memory serves me right, the disks you're thinking of were from Mastertronic or possibly Epyx (specifically, World Championship Karate, the only game by Epyx I had on floppy). There's a chance that it could have been one of Datasoft's games as well.

    --
    Fifty watts per channel, baby cakes.
    1. Re:Atari 800/C64 disks by WWWWolf · · Score: 1

      If memory serves me right, the disks you're thinking of were from Mastertronic or possibly Epyx (specifically, World Championship Karate, the only game by Epyx I had on floppy). There's a chance that it could have been one of Datasoft's games as well.

      World Karate Championship, a/k/a International Karate (System 3/Epyx)? Nope, at least my copy had Atari version on Side A and Commodore 64 version on Side B.

      However, I have to say I don't have my copy at hand, but I remember trying the Atari side on my C64 and predictably not getting it to work =)

  25. Re:I seem to recall that there were others like th by Anonymous Coward · · Score: 0

    I remember one of them being some sort of karate game. I'm thinking it was this one:
    http://www.mobygames.com/game/atari-8-bit/ninja_/screenshots

    I recall running the sector editor on the disk and finding out that if I did a copy of just the sectors the Atari would read onto a new disk, the game would work. The standard Atari DOS copy would fail because it would hit bad sectors (the C64 ones).

  26. That is just... by labmonkey09 · · Score: 0, Offtopic

    ...Awesome.

    --
    /LabMonkey09
  27. hey slashdot readers by Anonymous Coward · · Score: -1, Offtopic

    you're a bunch of fags!

  28. Re:There were a few hybrid formats around in the 8 by niklask · · Score: 1

    Impressive indeed! This also reminds me when I took a Pascal class in high school. We didn't do as much programming as fooling around since our teacher was a total geek too. A friend of mine was paying around with a floppy disk and all of a sudden DOS would report it as several GB. Of course, all data stored on it was corrupted.

  29. They might be multi-format by Sycraft-fu · · Score: 1

    CDs have various formats they can have written on them, and there is a Mac specific one. However, there isn't anything that neat about it since it is all part of the spec and you just tell your burner software how to handle it. I don't know all the details of all the different things you can do but mixing all sorts of different data modes on a CD is no big deal. Same kind of thing as mixed audio/data CDs.

  30. Re:There were a few hybrid formats around in the 8 by Anonymous Coward · · Score: 0

    The ST used a PC-like 720MB format, whereas the Amiga had its own filesystem that fitted 880MB on the same disk.

    MB might not be the units you're looking for here...

  31. Re:There were a few hybrid formats around in the 8 by Anonymous Coward · · Score: 0

    I think you meant KB!

  32. Comment removed by account_deleted · · Score: 1

    Comment removed based on user account deletion

  33. the good old days of 40/80 floppies. by gtoal · · Score: 1

    We used to do stuff similar to this at Acorn in the 80's, both for multi-system and for the same system but with both 40 and 80 track drives. I vaguely remember that one key feature was that one system numbered tracks from 1 upwards and another from 0 upwards, allowing for two separate directories. There were a lot of tricks that I've forgotten now. You could sometimes fit more than 80 tracks on a floppy. And then there was the 9 vs 10 sectors per track issue. I was only peripherally involved in this area, but we had a couple of guys who knew it inside out. In fact our guys who wrote our disk protection mechanisms were damn good at breaking everyone else's too :-) I remember tricks with using different FDC controllers and even at one point sticking pins into floppies at exactly the right spot to force a hard error on a sector...

    1. Re:the good old days of 40/80 floppies. by sandman_eh · · Score: 1
      The acorn scheme was the the essence of simplicity itself .

      It worked by zoning the disc like this:-

      track 0 - common.

      tracks 20-39 Data area 2.

      So if you take an 80 track disk, you format and your image to the disk with a 40 track drive. Touching (8 track) tracks 0,1 40 to 79.

      You can then go back with and 80 track drive and format and save the data to tracks 20-39 again.

      Of course some bigger games, like Elite used most of the top surface of the disk for 40 track drives and they put the 80 track game on the other surface. To achieve this they wrote te different data to the two data areas - so the 80 track image contained only a loader to use the other disk surface.

      --
      Master of Peng Shui.Ancient oriental art of Penguin Arranging)
  34. Comment removed by account_deleted · · Score: 1

    Comment removed based on user account deletion

  35. Eats Shoots & Leaves by Anonymous Coward · · Score: 0

    Nit pick-

    The improper phrase would have been "Knowing both IBM, and C64, MFM structures would allow..."

    As written without commas it does not imply that he is saying "IBM MFM and C64 MFM".

    It could have been clarified by writing "both IBM, and C64 MFM, structures would allow..."

    1. Re:Eats Shoots & Leaves by LocalH · · Score: 1

      Except for the fact that both of you are wrong because the C64 used GCR rather than MFM =P

      --
      FC Closer
  36. Starglider 2 by Saffaya · · Score: 2, Informative

    This game used a custom hybrid format so the same game disk worked on both ATARI ST and AMIGA.

    http://en.wikipedia.org/wiki/Starglider_2

  37. Funny I did the same thing on Color Computer Disks by dannycim · · Score: 1

    Way back when I was a 6809 freak, there was a period of time when I transited over from CoCo to PC. I used to format floppies on the PC, fill them with track-long files, figure out which ones where past track 16 or 17, rename them so they'd be invisible, and delete the others. Then I would format on the CoCo starting from track 17 and up, and mark the low "granules" (clusters of 9 sectors on the CoCo) as in use. I ended with floppies usable on both systems.

    Took a few days to figure out how the FAT worked on floppies, since I didn't have documentation. I think I a had utility called Norton Disk Editor or some such which let me see hex dumps of the sectors. Then I think I coded most of the thing in gwbasic, with maybe a tiny bit of assembler.

    Later I hacked my CoCo Disk ROM so I could read and write onto DOS-formatted floppies.

    Those were fun days.

  38. Puzzling Images? by offrdbandit · · Score: 1

    Granted these formats (and probably these disks themselves) are older than I am, the most surprising is that the data was readable at all (without some forensic intervention). Magnetic storage for going on 30 years is quite impressive.

  39. This is nothing new by Orion+Blastar · · Score: 3, Informative

    When I had my Amiga 1000 we had software that could do an Amiga, Macintosh, and MS-DOS format on the same floppy disk. You took like 100K to 200K parts of the disk and made a mini-format for each standard.

    There used to be software that made mini-standards and it was affordable for game companies to use the same floppy disk with two or more versions of their game on two different partitions of a floppy disk.

    For example one was a MFM format for the PC and the other was a GCR format for the C64.

    That was old school hacking, before "War Games" and people trying to crack computers and security and writing viruses. It is more of a computer hobbyist style of tweaking a computer that we computer geeks liked to use back in those days when being a "hacker" meant you wrote useful code that nobody else could to do impossible things like one floppy disk that supports two different formats at the same time. Back in the old days when programmers used machine code and assembly language and BASIC interpreters with peek and poke statements. Long before the GUI revolution and long before script-kiddies called themselves the new hackers, and are really crackers and not hackers at all.

    --
    Remember, Slashdot does not have a -1 disagree moderation, and no, troll, flamebait, and overrated are not substitutes.
    1. Re:This is nothing new by Jason+Scott · · Score: 1

      That was old school hacking, before "War Games" and people trying to crack computers and security and writing viruses.

      You were using your Amiga 1000 before "War Games" came out? That's pretty hardcore, man.

    2. Re:This is nothing new by Orion+Blastar · · Score: 1

      Yeah a bit of time travel was involved, but nevermind. :) It was a joke.

      --
      Remember, Slashdot does not have a -1 disagree moderation, and no, troll, flamebait, and overrated are not substitutes.
  40. Re:There were a few hybrid formats around in the 8 by Anonymous Coward · · Score: 0

    720MB on a 3.5 FLOPPY? ... wow ...

  41. *Thwack* by HiggsBison · · Score: 1

    Real programmers... yadda yadda yadda.

    Right. Now hit that link, leave your mouse on the comic, and read the title text.

    (Yeesh! &$%#@ amateurs!)

    --
    My other car is a 1984 Nark Avenger.
    1. Re:*Thwack* by zippthorne · · Score: 1

      We're already in the universe, fool. The rest of us don't get to create it.

      --
      Can you be Even More Awesome?!
  42. Commodore vs other formats by JoeCommodore · · Score: 1

    probably the other formats the directory starts on track 1 near the hub of the disk, where on the C64 and other DOS 2 disks the tracks started in the middle (track 18 of 35). So by doing a partial formatting you could write two formats on a disk.

    --
    "Enjoy what you're doing! If it becomes drudgery, you're doing it wrong!" - Jim Butterfield
  43. Re:There were a few hybrid formats around in the 8 by Pathwalker · · Score: 1

    Heh - I have similar memories of a high school Pascal class as well.

    I remember having lots of fun with directories; making infinitely deep nested structures, or playing with where . and .. linked to.

    Most of the Pascal coding I did was writing TSR programs to do annoying things after a few minutes had passed.

  44. Re:There were a few hybrid formats around in the 8 by niklask · · Score: 1

    Most of the other guys spent most of the time playing Doom or Rise of the Triad. At least I and a few others played around coding.

  45. Half Tracking by ACMENEWSLLC · · Score: 1

    I think we use to do this with what was called half tracking. On my 1541 I could tell the drive to set it's alignment 1/2 a track off of normal and store data there. If everything worked write, I could double the space used. You could also do this to have a multi-format disk.

    It didn't always work right and produced media that worked fine on my 1541 but not on other 1541's.

    Anyway, that's my recollection. It's been how many decades ago? We use to also change the HZ of our 300 Baud modems so we could squeeze 500bps on the upload. And my Internet users say 100Mb/s isn't enough for them, wah.

  46. Starglider! by mooterSkooter · · Score: 2, Interesting

    Starglider (from Rainbird) for Amiga & ST did this too. It really amazed me at the time especially because one side of the disk contained a sampled song that played at startup, so the exactly the same data was being played on both the rubbishy ST Yamaha sound chip and the awesome Amiga chip...Paula was it? I can't remember.

  47. Re: sheepish by Anonymous Coward · · Score: 0

    ViAAAAAAAgra

  48. Why the french? by Anonymous Coward · · Score: 0

    Isn't that just a redundancy of english? That's a waste of space, man. Charlemugnsdorf hates being called Chralemagne, but will settle for the english Charlyman. Germans rather be english than french.

  49. female programmers? by Anonymous Coward · · Score: -1, Troll

    but females can't program cuz theyz got hoofs.

    1. Re:female programmers? by Anonymous Coward · · Score: 0

      Either you are a horse/donkey, or you have never seen a female.

      Hmm... I wonder, which one is more likely here on Slashdot... :D

  50. A minor complication by Anonymous Coward · · Score: 0

    As I remember it, IBM format disks were 40-track, whereas the C64 disks (at least for the most common drives) had 35 tracks. The stepping on each track change was different - each disk could be made manually but I've no idea how they could be duplicated automatically...

    1. Re:A minor complication by thogard · · Score: 1

      The step size on the 35 and 40 were the same. The track size on the 80 was 1/2 what it was on the 40. Track 0 on all disks was at the same location.

  51. Re:There were a few hybrid formats around in the 8 by Anonymous Coward · · Score: 0

    720MB? Wow, you old farts sure had a lot of space available on your 3.5" floppies. Mine only had a paltry 720KB. Clearly our ancestors were wise in the ways of MFM.

  52. Laugh at copy protection by GottliebPins · · Score: 1

    I remember the days when we used to laugh at copy protection schemes. Deliberate errors or bad sectors, code that overwrote itself during loading to auto start, and those ridiculous dongles. I also remember the day we discovered that single sided disks were no different than the more expensive double sided disks. They just lacked a sector hole in the outer case. I remember taking 40 track floppies and formatting them to 43 tracks since the heads of most drives could actually move that far. And I remember one day after hacking a particularly complicated protection scheme in just a few hours I took the unprotected program, wrote it out to a floppy using a rather unique formatting program I wrote, on a floppy with TWO sector holes punched into the disk itself. Instead of 18 sectors per track it only had 9, twice! Two of each sector, so if you did a DIR you'd get a different result 50% of the time! The copy protection system required that each sector be read until two different sets of data were loaded and XOR'ed together. And the first sector of each track was 1024 bytes long instead of 256. And on the old CoCo the RAM vector for the floppy ROM routines were only about 500 bytes from the end of the read block area in memory, so as soon as you read the first sector you overwrote the RAM vector and the program started. All you had to do was DIR and the program started. Then I sent the floppy back to the company that created the software and told them, nice try, see if you can copy this! :)

  53. This is not that rare... by Anonymous Coward · · Score: 0

    I don't understand why people found this so interesting. It isn't rare. Many software companies released games in combo formats. There are plenty of hybrid Atari 800/C64 and Apple II/C64 disks around that I've archived (yes, on the same disk side). Now the IBM/C64 combination I haven't run across (that I know of) but it isn't surprising...

    http://c64preservation.com

  54. Re:There were a few hybrid formats around in the 8 by thogard · · Score: 1

    I don't remember doom running on the punch card machine.

  55. Re:There were a few hybrid formats around in the 8 by Anonymous Coward · · Score: 0

    MB? I think you may be a few orders of magnitude out...

  56. Re:There were a few hybrid formats around in the 8 by clone53421 · · Score: 1

    You haven't heard about the 720MB hyperfloppies? They exist in 1024 parallel universes, that's how they can store so much.

    --
    Alexander Peter Kristopeit bought his basement from his mommy for one dollar.
  57. Re:There were a few hybrid formats around in the 8 by Anonymous Coward · · Score: 0

    The ST used a PC-like 720MB format, whereas the Amiga had its own filesystem that fitted 880MB on the same disk.

    And for those of you not old enough to remember floppys those 720-880MB were actually kilobytes and nothing else.

    - Peder

  58. Fire Escape BBS List by Fire+Escape · · Score: 1

    I came across your comment from 2001 today and I wanted to let you know that I appreciated it. I never got much thanks for my efforts and it was very nice to finally get some from someone. FYI - there are a lot of people from the BBS community trying to reconnect at bbsmates.com if you are interested. Also MySpace has a lot of BBS nostalgia groups by area code as well. Tanis (pka Fire Escape) http://www.sugarbane.com/