Slashdot Mirror


Sklyarov, Elcomsoft Plead Not Guilty

squared99 writes: "I'm sure it has already flooded slashdot, but Dmitri has entered his plea, not guilty. This NYTimes article talks about it. Not sure I like the mention of bumper stickers, as opposed to the real people who have been protesting, but at least it talks about the support he has been getting. It even appeared as one the main newsworthy item on my daily NYTimes newsletter, Yay! Let's keep up the support and protests. As my brother said to me the other day, "The only way to beat bullies is to stand up to them."" See also Elcomsoft's statement about the case, a story in the Boston Globe, and this cute fable about a DMCA future. Update: 08/31 19:37 PM GMT by M : one more link - the Russian Foreign Ministry has warned its programmers not to travel to the United States.

484 comments

  1. hey by Anonymous Coward · · Score: -1, Troll

    i know..

    1. Re:hey by Anonymous Coward · · Score: 0

      first reply to first post !

      Has it been 20 seconds yet ?

    2. Re:hey by Anonymous Coward · · Score: 0

      I'm a professional troll with a minor in Tedious Studies. Hear my r0aRRRRRRRRRRRRR
      faaaq
      cfdode
      osdn df
      awards
      fag
      code
      faq
      codeine
      osdn
      awards

      osdn
      awards
      dialup modems
      three little piggies
      faq
      code
      osdn
      awards for malda: 0

  2. fp by lunchroombob · · Score: -1

    fp

  3. EVERYBODY LOVES POKEY!!!! by Anonymous Coward · · Score: -1, Flamebait
    mmmmmmmmmmm
    mmmmmmmmmmmmmm
    mmmmmmmmmmmmmmmmm
    mmmmmmmmmmmmmmmmmm
    mmmmmmmmmmmmmmmmmmm
    mmmmmmmmmmmmmmmmmmmm
    mmmmmmmmmmmmmmmmmmmmmm
    mmmmmmmmmmmmmm mmmmmmmm
    mmmmmmmmmmmmmmm mmmmmmmmm
    mmmmmmmmmmmmmmmmm mm mmmm mm
    mmmmmmmmmmmmmmmmmm mmm m
    mmmmmmmmmmmmmmmmmmmmmmm m mmmm
    mmmmmmmmmmmmmmmmmmmmmm m mm
    mmmmmmmmmmmmmmmmmmmmmm m m
    mmmmmmmmmmmmmmmmmmmmm mmmmmmmmmmm
    mmmmmmmmmmmmmmmmmmmmmm m m
    mmmmmmmmmmmmmmmmmmmmmm m mmmmm
    mmmmmmmmmmmmmmmmmmmmm mmmmm
    mmmmmmmmmmmmmmmmmmmm m
    mmmmmmmmmmmmmmmmmmm m
    mmmmmmmmmmmmmmmmmmm m
    mmmmmmmmmmmmmmmmmmm m
    mmmmmmmmmmmmmmmmmmm m
    mmmmmmmmmmmmmmmmmm m
    mmmmmmmmmmmmmmmmmm m
    mmmmmmmmmmmm mmmmm m
    mmmmmmmmmmmm mmmmm m
    mmmmmmmmmmmm mmmm m
    mmmmmmmmmmmmmmmmm m
    mmmmmmmmmmmmm mmm m
    mmmmmmmmmmmm mmm m
    mmmmmmmmmmmm mmm m
    mmmmmmmmmmmm mm m
    mmmmmmmmmmmm m
    mmmmmmmmmmmm m
    mmmmmmmmmmm m
    mmmmmmmmmmm m
    mmmmmmmmmmmm m
    mmmmmmmmmmmm m
    mmmmmmmmmmmm m
    mmmmmmmmmmmm m
    mmmmmmmmmmmmmm mm
    mmmmmmmmmmmmmmmm m m
    mmmmmmmmmmmmmm m mm
    Subject: Comment (Use the Preview Button! Check those URLs! Don't forget the http://!) Post Anonymously Allowed HTML:

      • * Important Stuff: Please try to keep posts on topic. * Try to reply to other people comments instead of starting new threads. * Read other people's messages before posting your own to avoid simply duplicating what has already been said. * Use a clear subject that describes what your message is about. * Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page) Problems regarding accounts or comment posting should be sent to CowboyNeal. Unfair animal names: -- tsetse fly -- bullhead -- booby -- duck-billed platypus -- sapsucker -- Clarence -- mmmmmmmmmmmmm m mmmm
        mmmmmmmmmmmmmmmmmmmm
        mmmmmmmmmmmmmmmmmmmmm
        mmm mmmmmmmmmmmmmm
        mmm m
        mm
    1. Re:EVERYBODY LOVES POKEY!!!! by Anonymous Coward · · Score: -1, Offtopic

      Not me!

  4. We need better sign makers by Anonymous Coward · · Score: -1, Offtopic
    1. Re:We need better sign makers by wysoft · · Score: -1, Offtopic

      Neither does that "You are stupid" binry shirt from ThinkGeek.

      --
      -- I'll cut you up so bad, you'll wish I'd never cut you up so bad!
  5. Guilty! by Spootnik · · Score: -1

    Why should we support a criminal? Answer me!

    No matter how you hate Adobe or big corps, Dmitri is guilty, let's face it.

    1. Re:Guilty! by Anonymous Coward · · Score: 0

      You fool! Next time I'll get mod points, I'll use all five of them to mod five of your posts down. And I'm sure many others will do the same. Ya know, Overrated mods don't show up in metamod. That'll teach you to post your tripe anonymously next time.

    2. Re:Guilty! by Anonymous Coward · · Score: 0
      Hey,


      Just because your a spammer doesn't mean you can't be right. You're dead on the money, this guy is guilty. Let him fry.

  6. Here's what I hope they do with the DMCA by Anonymous Coward · · Score: -1, Offtopic
    ___....---"""".
    ." ". D \
    / \ M i
    i i i
    i__ _ i C i
    " "\\ i i
    || i A i
    __.// i _ . - "i
    \ i- " i
    i ii D i
    \ / i i
    "._.--"i M i
    i i
    i C i
    i _i
    i A _.-"
    i _.-"
    i-"

    Important stuff:

    • Try to keep posts on topic.
    • Try to reply to other people comments instead of starting new threads.
    • Read other people's messages before posting your own to avoid simply duplicating what has already been said.
    • Use a clear subject that describes what your message is about.
    • Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page)

    Problems regarding accounts or comment posting should be sent to CowboyNeal.

    1. Re:Here's what I hope they do with the DMCA by Anonymous Coward · · Score: 0

      That is some excellent ASCII art. Nice-looking post (and the text).

    2. Re:Here's what I hope they do with the DMCA by Anonymous Coward · · Score: 0

      May I suggest a small change?

      ___....---"""".
      ." ". D \
      / \ I i
      i i M i
      i__ _ i I i
      " "\\ i T i
      || i R i
      __.// i _i . - "i
      \ i- " i
      i ii Prison i
      \ / i i
      "._.--"i Bitch i
      i i
      i Ass i
      i _i
      i Blotter_.-"
      i _.-"
      i-"

      Now I belive this fine art is back on topic!

  7. Skylarov not guilty in the eyes of Justice by Kiss+the+Blade · · Score: 2, Interesting
    But he is guilty in the eyes of the law, as far as I can see. The DMCA may be an unfair law, and not 'justice', but there is a greater thing at stake here - the overall Justice of the law. Even where the law is wrong it must be obeyed, and must only be amended through democratic action. I for one support the actions against Skylarov, with heavy heart, for I support the rule of law above all else.

    This is not to say I won't be campaigning against the DMCA, however.

    I think I am in line with the more controversial commentators on this issue, but I feel it is the only honest line.

    --

    KTB:Lover, Poet, Artiste, Aesthete, Programmer.
    There is no

    1. Re:Skylarov not guilty in the eyes of Justice by SirGeek · · Score: 1

      But what he did is perfectly legal in his country.

      They require that you be able to create back up copies of your products.

      What do you think would happen if EVERY GEEK in this country went and formed a class action suit against all the companies that use copy protection schemes. We might have a case because we have the right to create a backup copy of our electronic media.

    2. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: -1, Flamebait

      I don't see how you can defend someone who uses copyright law to make a profit on one hand and then breaks copyright law to make a profit on the other. I have no respect for that.

    3. Re:Skylarov not guilty in the eyes of Justice by cmorriss · · Score: 3, Insightful

      "Even where the law is wrong it must be obeyed"

      Is the criminal justice system not part of our democracy? You seem to imply laws can only be changed if the Congress passes a law to repeal it. That's not true at all. If the law is unconsititutional, the judicial system has more than enough power to declare it so.

      Sounds like you're fighting for the wrong side.

      --
      10 minutes working on a sig. What a waste.
    4. Re:Skylarov not guilty in the eyes of Justice by gwallen3141 · · Score: 1

      Guilty of what, exactly? He created a 'circumvention device' but he didn't do it here. As far as I know he didn't try to market/sell/distribute a 'circumvention device' - his employer did. He did speak about a 'circumvention device' in this country but in a scholarly fashion at a professional conference.

    5. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0

      Ahh, but his defence minght be that the law is unconstitutional or is superceeded by an older law etc etc.. in that case he would plead not guilty. This could be a great thing for everyone not just him.

    6. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0
      "Even where the law is wrong it must be obeyed", huh... Well, he was obeying the law in his own country and he wasn't breaking any laws in America. He was arrested for what he did on Russian soil. What's next, the US Authorities going to London and picking up someone and arresting them for something the American Government doesn't like, irregardless of political boundaries and jurisdictions?



      America is taking the "police the world" thing too far.

    7. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0
      But what he did is perfectly legal in his country.

      But they imported the software & primarily distributed to the US. You need to read the indictment because they specifically cite actions that happened on US soil.

      Businesses incorporated in the US can't go around breaking the law in the US just because some of their employees are not US citizens.

    8. Re:Skylarov not guilty in the eyes of Justice by Remote · · Score: 2

      I fully agree with the gist of your post, but let's not call him guilty, that's not up to you or I to say. If you are such a strong believer in Justice of the Law, let the courts decide. And yes, I saw the "as far as I can see" part.

      On a side note: what I understand from this is that everyone who is or has been an employee of ElcomSoft, or anyone who has somehow contributed to the "effort" is subjected to arrest upon entering the USA. Maybe one wouldn't even need to enter the USA (think Noriega). I think this extreme scenario highlights how law and justice can be apart, as you suggested.

    9. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0
      Guilty of what, exactly?...he didn't...his employer did...

      Read the indictment, its very specific, it does also charge his employer, and the actions that he/they were charged with did happen in the US.

    10. Re:Skylarov not guilty in the eyes of Justice by Pi-Zero+Meson · · Score: 1

      "It is the duty of every just citizen to disobey any unjust law"
      HDT

    11. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0

      They have not arrested his employer. They have arrested Slyarov who has done nothing in this country except give a lecture which would be protected by the 1st Amendment to the United States constitution.

      If he had been an executive of Elcomsoft they would have a case. He is not, to my knowledge, an executive or member of the board of directors, or a controlling stockholder. I think, with proper lawyering, he will win.

    12. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0
      He was arrested for what he did on Russian soil.

      no he wasn't.

    13. Re:Skylarov not guilty in the eyes of Justice by tshak · · Score: 3, Insightful
      Skylarov not guilty in the eyes of Justice, but he is guilty in the eyes of the law, as far as I can see.

      Not quite. Two simple points prove this statement wrong:

      • It is arguable if parts of the DMCA is constitutional. If the law is unconstitutional, it can not be upheld.
      • It is arguable if he violated the DMCA while in the US.

      --

      There is no longer anything that can be done with computers that is nontrivial and clearly legal. -- Paul Phillips
    14. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0
      "It is the duty of every just citizen to disobey any unjust law? HDT

      Sklyarov isn't a citizen.

      Seriously, I have yet to hear one _valid_ use of this system. Text-to-speech is offered by the Adobe software, and backups/archiving can happen in encrypted form. If you know of one good reason why you should be able to decrypt ebooks without having a valid key from the authors, let me know.

    15. Re:Skylarov not guilty in the eyes of Justice by Xanlexian · · Score: 2, Informative

      Just a quick note --- We're (the USA) a republic, not a democracy.

      --Xan

      --
      "Congratulations, Boots. Your robot has become self-aware. You're a daddy now." -- Dr. Rho Bowman
    16. Re:Skylarov not guilty in the eyes of Justice by Chris+Y+Taylor · · Score: 3, Insightful

      As cmorriss points out, laws in the U.S. are not only amended through the legislature, they are also declared null and void if they are found unconstitutional by The Court. This does NOT require any sort of "democratic action". In fact, if the Supreme Court rules that a law is unconstitutional then it doesn't matter how popular it is with the public, it is gone. Personally I rather like it that way; it prevents a "tyranny of the majority" and protects even unpopular rights and the rights of unpopular groups (to a point).

      I suspect DMCA is very unconstitutional, and hopefully if EFF can make a good enough case The Court can be convinced to overturn it; so supporting them in this effort is important.

      Your "democratic action" does have its place. Even if it doesn't reverse this law, making your displeasure over DMCA known (in an thoughtful, clear fashion) to your representatives in Congress gives them feedback on the quality of their legislation and may prevent future similar "bad laws" from being enacted in the 1st place. This feedback is very important, but often times legislatures get insulated from the results of their work, and then some poor person (like Dimitri) has to be the "test case" victim to get it corrected in The Courts.

      "Democratic action" has its place, but democracy (or in our case a republic) without constitutional restrictions and a judiciary system is tyranny waiting to happen.

      While in theory I also disagree that all "wrong laws" must be obeyed, in this context the difference is only academic. The injustices and tragedies of war are so great that I think the laws must be very, very wrong and very, very uncorrectable before that step can be justified. But having your gov't know in the back of their mind that they could never rule out such a response is a useful deterrence to extremist bureaucrats.

    17. Re:Skylarov not guilty in the eyes of Justice by Sarcasmooo! · · Score: 2

      I would've partly agreed with you a few days ago, because if there's even a significant chance that he could be convicted, I would prefer to see him take a plea and get back to Russia. But I'm no lawyer, and I assume you're not either. I don't support the actions against him, for that reason, and for the same reasons fcd pointed out; that, by our nature, Americans don't support the rule (as in reign) of law. I can't pretend to know better than the EFF lawyers what path to take. Anyway, wouldn't those scales of justice things that sit in courtrooms mean something here?

    18. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0
      They have not arrested his employer

      Its impossible to "arrest an employer", but they have indicted Elcomsoft Co. Ltd., as I said in the message you responded to. They are plainly listed as a defendant in the indictment that you didn't bother to read.

    19. Re:Skylarov not guilty in the eyes of Justice by schon · · Score: 1

      Its impossible to "arrest an employer"

      Bullshit.

      An "employer" can be a person, just as easily as it can be a corporation.

      In the case of it being a corp, you arrest the board of directors, or the owner, or whoever is in charge. Simple.

      In fact, the president of Elcomsoft (Alexander Katalov) came to the conference with Dmitry, and yet he wasn't arrested.

      So again, they haven't arrested his employer.

    20. Re:Skylarov not guilty in the eyes of Justice by xcomputer_man · · Score: 1
      I guess this would make a very interesting poll:

      All who agree with the statement "The DMCA is an evil communist law.", say AYE.


      Mayday, mayday, XComputer_Man to Slashdot: do you copy? Still no response.
    21. Re:Skylarov not guilty in the eyes of Justice by Col.+Panic · · Score: 1
      what I understand from this is that everyone who is or has been an employee of ElcomSoft, or anyone who has somehow contributed to the "effort" is subjected to arrest upon entering the USA

      I'm not so sure about this. Sklyarov gave a speech in the U.S., but the development was done in Russia, so I don't know if anyone else in the company can be prosecuted unless they too try to market the software in the US.

    22. Re:Skylarov not guilty in the eyes of Justice by Noer · · Score: 2

      Sometimes, the only way to wake the public up to the fact that some laws are immoral or unjust is to violate those laws.

      What if the State prohibited protest, and in fact prohibited trying to change the law in any way. Then even "democratic action" to change that law would be illegal. Thus, violating the law could be considered a moral imperative.

      To put it another way, laws exist to try to keep society ordery. But when the laws are unjust, they must be changed, and it is possible that those laws will need to be broken to reform them. Laws do not equate to morals. I think there are many things that are illegal but not immoral, as well as many things that ARE immoral but not illegal.

      Not everybody has the same morals, though on a Federal level this country has unified laws. However, some of those laws have been bought and paid for by large corporations, in a very undemocratic manner. When corporate lobbyists and greedy politicians ignore their constituents (which is easy since most Americans are now complacent tv-absorbing vegetables anyways, thanks to corporate america and the dumbing-down of media as well as education) then democracy is broken.

      Turn it around - what if the law REQUIRED that all Blacks and Jews be rounded up and turned into the police for extermination. You'd be violating the law by providing safe harbor to those people whose lives were at stake. Would such a violation of the law be wrong? When slaves in America were just property with no rights, were the people who freed and protected them from unjust laws doing something wrong? How is it forgivable to obey the law (and thus allow innocent people to suffer) just because you don't want to break the law?

      There's another point to be made. It's damn hard to get a law overturned, especially if nobody's been affected by it. If Sklyarov and the EFF manage to get the DMCA repealed (or modified), by showing how the law as it stands is unjust, then wasn't Sklyarov doing the RIGHT thing (albeit unknowingly) by violating an unjust law and thus provoking a TEST CASE to get the unjust law thrown out?

      --
      -- "Those who cast the votes decide nothing. Those who count the votes decide everything." -Joseph Stalin
    23. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0
      So again, they haven't arrested his employer.

      So what? They've indicted Elcomsoft, which makes the point I was trying to make - that they did go after the company in addition to Sklyarov. Do you actually want Katalov arrested, or is just the indictment against his company OK?

    24. Re:Skylarov not guilty in the eyes of Justice by rking · · Score: 1

      But they imported the software & primarily distributed to the US. You need to read the indictment because they specifically cite actions that happened on US soil.

      Actions by Dmitry Skylarov?
      Businesses incorporated in the US can't go around breaking the law in the US just because some of their employees are not US citizens.

      Whether any business anywhere committed any offence under any law isn't even an issue here. The question is whether Dmitry Sklyarov did. The idea of arresting someone on the basis of allegations against his employer is utterly abhorrent.

    25. Re:Skylarov not guilty in the eyes of Justice by rking · · Score: 1

      So what are you saying he was arrested for? That document details that he wrote a program, in Russia not in the USA. It details that his employer, for whom he perfectly lawfully wrote the program (in Russia, remember?) sold the program over the internet. It also details that he was scheduled to talk at a conference.

      Which action by him, NOT his employer are you saying he was arrested for? The ONLY thing that document says he did on US soil was being scheduled to give a speech at a conference. Is that it?

      I assume you did actually read the substance of the allegations, not just the charges?

    26. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: -1, Troll
      Actions by Dmitry Skylarov?

      I'm not going to walk you through the indictment. If you don't want to read it that's fine, but please refrain from replying until you obtain at least the slightest bit of information about the case, such as what he's charged with. Whether any business anywhere committed any offence under any law isn't even an issue here.

      Well, since Elcomsoft is listed as a defendent, I'd say it is. This is pretty standard - if you smuggle in drugs they don't drop the charges just because you're working for a drug lord. "I was just following orders" went out in the 40s.

    27. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 1, Interesting

      "Even where the law is wrong it must be obeyed"

      I believe this is called the nuremberg defense (because it is what the nazi war criminals said during their trials) either way, it's not absolutely true in a legal sense and it's absolutely not true in an ethical one.
      (ditto to Xanlexians comment about democracy, we ain't one and it's a good thing)

    28. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0
      So what are you saying he was arrested for? The ONLY thing that document says he did on US soil was being scheduled to give a speech at a conference. Is that it?

      I assume you did actually read the substance of the allegations, not just the charges?

      Goddamn, I'm tired of helping people comprehend basic English text: all five counts indict both Elcomsoft AND Sklyarov with the actions listed. That's what the "ELCOM LTD. and DMITRY SKLYAROV" means when it lists the defendants for each count, and it didn't "happen in Russia" since all five are trafficking charges (which means that they are related to the act of the defendants of bringing the software into the United States), which you can be charged with regardless of what country you come from (c.f. drug lords). Is that clear? I hope you can understand that.

    29. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0

      The DMCA may be an unfair law, and not 'justice', but there is a greater thing at stake here - the overall Justice of the law. Even where the law is wrong it must be obeyed, and must only be amended through democratic action.

      Nonsense. The DMCA is a purchased law. I don't feel obligated to obey purchased laws. I know, you want to preserve respect for the Law, but in my mind, that died the day my suffrage was sold by my representatives. Further, democratic action doesn't work in the face of widespread governmental corruption. The only remaining way to change the law, is to break the law.

      Now 'scuze me while I go change the law some more.

    30. Re:Skylarov not guilty in the eyes of Justice by spankfish · · Score: 1
      All who agree with the statement "The DMCA is an evil communist law.", say AYE.


      Close. I'd say it's an evil plutocrats' law.

      --

      NO TOUCH MONKEY!
    31. Re:Skylarov not guilty in the eyes of Justice by SlippyToad · · Score: 2
      The problem is, the DMCA diminishes our respect for the law, and those who create it. It was so clearly bought for the narrow goals a special interest group, and passed almost in secret. It demonstrates the depth of corruption in our government, and the moral bankruptcy of our culture. That a corporation needs to take away the rights of citizens (who happen to be their customers, but are citizens of a free country first) to be curious about the nature of the product they buy, in order to prevent a corporation's unnatural business model, is a sign that the corporation has lost touch with reality, and expects society to perserve its existence and profits in spite of its obvious flaws. E-books don't work, and won't work. No one wants pay-per-read, pay-per-view, or pay-per-listen. The enraged public reaction to Divx proved that conclusively.

      Even where the law is wrong it must be obeyed,

      A law this wrong cannot be obeyed. It forbids a broad range of activities under which almost anyone involved in digital information technology could be culpable. It is for all appearances designed to produce a witch hunt-style atmosphere among computer intelligentsia which will paralyze criticism and independent thought. Any one of us could be guilty of circumventing encryption technology by peeking where we ought not. It treats programming as a black art, and criminalizes casual behavior that may or may not have real criminal intent.

      --
      One day I feel I'm ahead of the wheel / the next it's rolling over me / I can get back on / I can get back on
    32. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0

      AYE

    33. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0

      umm, they hosted the download site for aebpr in the US, and they collected payments through a registration service in the US. Is this not "market[ting] the software in the US"??????

    34. Re:Skylarov not guilty in the eyes of Justice by rking · · Score: 2, Insightful

      I'm not going to walk you through the indictment [usdoj.gov]. If you don't want to read it that's fine, but please refrain from replying until you obtain at least the slightest bit of information about the case, such as what he's charged with.

      I have read it. What I'm wondering is whether you have. None of it mentions Dmitry Sklyarov being involved in selling software in the USA. It talks about him authoring it in Russia, where it was lawful for him to do so, it talks about his employers selling it through a distributor in the USA, it talks about him being scheduled to give a speech at a conference in the USA.

      Whether any business anywhere committed any offence under any law isn't even an issue here.

      Well, since Elcomsoft is listed as a defendent, I'd say it is.


      To the charges against Elcomsoft, sure. But not to the charges against Dmitry Sklyarov. He did not sell software in the USA.

      This is pretty standard - if you smuggle in drugs they don't drop the charges just because you're working for a drug lord. "I was just following orders" went out in the 40s.

      But NOTHING in the indictment suggests that Dmitry Sklyarov did anything remotely analogous to smuggling in drugs. He wasn't selling or otherwise distributing the software in the USA.

    35. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: -1, Troll

      WELSH COCKS

    36. Re:Skylarov not guilty in the eyes of Justice by jcr · · Score: 3, Insightful

      "Even where the law is wrong it must be obeyed"

      Hogwash. When the law is wrong, it is the DUTY of decent people to disobey it.

      -jcr

      --
      The only title of honor that a tyrant can grant is "Enemy of the State."
    37. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0
      None of it mentions Dmitry Sklyarov being involved in selling software in the USA... He did not sell software in the USA...He wasn't selling or otherwise distributing the software in the USA.

      11. as part of the conspiracy, and to further the objects therof, the defendents committed the following overt acts in the Norther District of California:

      a. Beginning on or about June 20, 2001, the defendants offered the Advanced eBook Processor for sale in San Jose, California, and elsewhere, on the elcomsoft.com website
      b. On or about June 26, 2001, the defendants caused a purchaser in California to send a payment of approximately $99 to RegNow; and
      c. On or about June 26, 2001, the defendants sent registration key for a copy of the AEBPR program to an individual purchaser in San Jose, California, who had made a payment of approximately $99 to RegNow,
      All in violation of Title 18, United States Code, Section 371

      (Note "the defendants" are expressly listed in this count as both Dmitri and Elcomsoft.)

    38. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0

      P L E A S E: Do not feed the Trolls!

    39. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0

      It is a little known fact that it is not merely the defendant, but the law that is on trial in a jury trial.
      A jury can aquit a man, even if he is clearly guilty under law, if they believe the law is 'wrong'.
      The classic example dates back to the 16th century in England when a jury refused to convict two men accused of blasphemy.
      Until the mid 19th century, it was required that the jury be informed of this option. However, this is no longer the case, and is rarely brought to the attention of jurors, even by the defence team.
      Maybe this would be a good time to try this?

    40. Re:Skylarov not guilty in the eyes of Justice by Anonymous Coward · · Score: 0

      Well, did they host the site or did they merely commission a provider to do so? So they employed agents in this country to advertise and collect fees for their product - big deal. They are an off-shore company that has done some business here, but is not located in the States. The government can shut down their website - case closed.

  8. - Why Open Source / Linux Sucks - by Anonymous Coward · · Score: -1, Troll

    The terms "opensource" and "Linux" are nothing but buzzwords created by the jews to promote free-software, when in fact they are without a doubt profiting highly from this so-called "free" software.

    The terms "opensource" and "Linux" are nothing but buzzwords created by the jews to promote free-software, when in fact they are without a doubt profiting highly from this so-called "free" software..

    The terms "opensource" and "Linux" are nothing but buzzwords created by the jews to promote free-software, when in fact they are without a doubt profiting highly from this so-called "free" software...

    The terms "opensource" and "Linux" are nothing but buzzwords created by the jews to promote free-software, when in fact they are without a doubt profiting highly from this so-called "free" software....

    The terms "opensource" and "Linux" are nothing but buzzwords created by the jews to promote free-software, when in fact they are without a doubt profiting highly from this so-called "free" software.....

    The terms "opensource" and "Linux" are nothing but buzzwords created by the jews to promote free-software, when in fact they are without a doubt profiting highly from this so-called "free" software......

    The terms "opensource" and "Linux" are nothing but buzzwords created by the jews to promote free-software, when in fact they are without a doubt profiting highly from this so-called "free" software.......

    The terms "opensource" and "Linux" are nothing but buzzwords created by the jews to promote free-software, when in fact they are without a doubt profiting highly from this so-called "free" software........

  9. dimitry is an ass, heres the pic to prove it by Anonymous Coward · · Score: -1, Flamebait


    * g o a t s e x * g o a t s e x * g o a t s e x *
    g g
    o / \ \ / \ o
    a| | \ | | a
    t| `. | | : t
    s` | | \| | s
    e \ | / / \\\ -- \\ : e
    x \ \/ --~~ ~--| \ | x
    * \ \-~ ~-\ | *
    g \ \ .--------.__\| | g
    o \ \_// ((> \ | o
    a \ . C ) _ ((> | / a
    t /\ | C )/ \ (> |/ t
    s / /\| C) | (> / \ s
    e | ( C__)\__/ // / / \ e
    x | \ | \\__// (/ | x
    * | \ \) `---- --' | *
    g | \ \ / / | g
    o | / | | \ | o
    a | | / \ \ | a
    t | / / | | \ |t
    s | / / \/\/ | |s
    e | / / | | | |e
    x | | | | | |x
    * g o a t s e x * g o a t s e x * g o a t s e x *

    1. Re:dimitry is an ass, heres the pic to prove it by Anonymous Coward · · Score: 0

      5. So, Mr. Sklyarov, how did you pass your time in prision?
      4. What is your opinion of Adobe's 'l33+ 'cryp+10n 5k1||z?
      3. What's your opionon of the justness of the DMCA?
      2. How was the food in prison?
      1. Can I have my watch back?

  10. This story best experienced with by Anonymous Coward · · Score: -1, Offtopic

    ..
    .o888o.
    ... dF' `8
    .o8888888o .8
    o88888888888. .8
    o8888888888888. P
    o888888888888888.
    .8888888"""8888888
    8888888' `888888:
    .88'8888 8888888
    :8"o8888888888888888
    :".88888888888888888
    .888888888888888888
    8888888"""""""""""'
    .8888888. .oooooo
    88888888o 888888"
    888888888b__d888888
    88^888888888888888'
    :8" 88888888888888'
    :8 888888888888'(R)
    :8 `88888888'
    -8 _dF""""
    `8ouo8"
    "^"

    1. Re:This story best experienced with by Anonymous Coward · · Score: 0

      Microsoft supernerds are our superiors!
      You cannot argue with the manifest truth. Just look at IE versus Mozilla.

  11. COMPSEX by Anonymous Coward · · Score: 0

    I had sex with my computer today

    1. Re:COMPSEX by Anonymous Coward · · Score: -1, Offtopic

      G4 tower?

    2. Re:COMPSEX by Anonymous Coward · · Score: 0

      Me too! I also had sex with your computer. I hope you washed it!

      Love those smooth round Apple mice.

  12. Protests are nice and alll... by DESADE · · Score: 1

    But does anyone really think that protest, bumper stickers and popular support will really do anything to make the feds pull back? We're talking about the Bush administration here. It might be better to put the money into some hired gun lawyers. I think the only way to win this one is a good fight in the courts. Otherwise, our friend from Russia will be the poster boy for what happens when you f##k with the DMCA.

    1. Re:Protests are nice and alll... by brlewis · · Score: 2, Insightful

      Without action to raise public awareness, people will think laws are being passed to "protect intellectual property" rather than to take away constitutional rights for the convenience of industry.

  13. or, as most sheeple say by Anonymous Coward · · Score: 0
    As the average person I've run into will state:



    "If he hadn't been doing that bad stuff, he wouldn't be in this situation. He deserves what he gets."

    Seriously, folks. Your average American believes that if Uncle Sam says you've done something wrong then you have. And if you have, then you deserve to have your constitutional rights trampled on and you deserve to be treated like a dog.



    Further, the American people obviously believe that it's wrong to hold American's captive in foreign lands and hold them accountable for crimes supposedly committed in whatever country they are in but it's alright for us to do whatever we want to foreigners visiting OUR country. God bless hypocrisy.

  14. Michael, slashdot post old story by Anonymous Coward · · Score: 0

    Sims denied that the recent CHAOS^H^H^H^H^H problems with slashdot was due to a migration to IIS/MSSQL server.

  15. 1984 by Anonymous Coward · · Score: 0

    Anyone here who hasn't had a chance to read it yet really should.

    Just remember that the book was first published in 1949.

  16. slashdot = censorware. by Anonymous Coward · · Score: -1, Offtopic
    Looks like slashdot is deleting comments in old stories. This article had an ASCII goatse.cx as the first comment in its archived, shtml version. Now that it's been imported back into the database, the comment is nowhere to be found.

    .

    Looks like slashdot is deleting comments in old stories. This article had an ASCII goatse.cx as the first comment in its archived, shtml version. Now that it's been imported back into the database, the comment is nowhere to be found.

  17. Dmitry's so hot! He makes me want to by Anonymous Coward · · Score: -1, Troll
    +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+
    * \ \ \ *
    j / \ \ j
    a \ \ a
    c \ \ c
    k / \ \ \/,,..---v--. k
    o ,,\.--"""\/ \ o
    f \ > f
    f / f
    * /vvv\..---""'`-' *
    j ,,. j
    a / \ \hhh/ a
    c c
    k k
    o \ \ o
    f \ \/ f
    f \ f
    * \ *
    j j
    a a
    c c
    k k
    o o
    f f
    f f
    * *
    +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+

    * mportant Stuff: Please try to keep posts on topic. * Try to reply to other people comments instead of starting new threads. * Read other people's messages before posting your own to avoid simply duplicating what has already been said. * Use a clear subject that describes what your message is about. * Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page) Problems regarding accounts or comment posting should be sent to CowboyNeal.

  18. THIS JUST IN! by oliphaunt · · Score: 1, Offtopic

    See what President Georege W. Bush has to say about this!

    ok, so I'm lying. At least it't not goat related.

    --




    Humpty Dumpty was pushed.
    1. Re:THIS JUST IN! by j7953 · · Score: 2

      Well, he certainly manages to make Slashdot stories look much better.

      --
      Sig (appended to the end of comments I post, 54 chars)
  19. REGGE DUNLOP by Spootnik · · Score: -1

    Vot' garçon m'a l'air d'une future tapette. Vous êtes mieux d'vous r'marriez sans ça y'a des chances qu'un beaux matins vous r'trouviez vot' gars en train d'sucer un homme!

  20. Miscommunication by omarius · · Score: 1, Offtopic
    "The only way to beat bullies is to stand up to them."

    I read this as,

    "The only way to beat bullets is to stand up to them."

    and thought, ummmm, "No."

    :P,

    -Omar

    1. Re:Miscommunication by greyrat · · Score: 1

      I read it correctly and still thought, ummmm, "No."

      --

      "There is no reason anyone would want a computer in their home." -- Ken Olson, 1977
    2. Re:Miscommunication by bonzoesc · · Score: 3, Funny

      Maybe they got confused and meant "The only way to beat bullies is bullets." Remember, ranged weapons are here for the scrawny guys like us.

    3. Re:Miscommunication by Chris+Y+Taylor · · Score: 2, Interesting

      What about: "The only way to beat bullies is asymmetric warfare"?

    4. Re:Miscommunication by SuiteSisterMary · · Score: 3, Funny

      "The Gods made us all, but Armour-Piercing Discarding Sabot rounds made us all equal."

      --
      Vintage computer games and RPG books available. Email me if you're interested.
    5. Re:Miscommunication by sacrilicious · · Score: 1
      Maybe they got confused and meant "The only way to beat bullies is bullets."

      When I first read it, I thought it said "the only way to beat bullets is to stand up to them." I thought wow, SOMEBODY really liked The Matrix.

      --
      - First they ignore you, then they laugh at you, then ???, then profit.
  21. A little late by Staciebeth · · Score: 0, Offtopic

    Why did it take Slashdot so long to post this story? I used to come to Slashdot to get news before I could get it elsewhere, but I heard this at 7 AM on NPR! Sheesh.

    1. Re:A little late by Anonymous Coward · · Score: 0

      Shut the fuck up and quit whining. If you don't like slashdot, then fucking leave. Fucking wanker.

    2. Re:A little late by Anonymous Coward · · Score: 0

      Oh yes, mustn't criticize the blessed slashdot! Shame shame shame.

  22. Rumor has it that Dmitry writes spamming tools by Russ+Nelson · · Score: -1, Offtopic

    Rumor has it that Dmitry spends his spare time when not breaking into ebooks writing spaming software. You know, for scraping web pages and spamming the addresses found there. Can anyone verify this rumor (No, I won't tell you where I heard it, because the idea is to get another independent source for it).
    -russ

    --
    Don't piss off The Angry Economist
    1. Re:Rumor has it that Dmitry writes spamming tools by Anonymous Coward · · Score: 0

      Take your black propaganda and SUYA!

    2. Re:Rumor has it that Dmitry writes spamming tools by Anonymous Coward · · Score: 0

      Good, good, following the journalist's code of ethics where it states, 'two rumors = truth'

    3. Re:Rumor has it that Dmitry writes spamming tools by Anonymous Coward · · Score: 0

      Can't one simply go to the website of his employer and see that they're selling email address harvesting software? I don't have the link but I remember seeing it here in a previous article on this guy.

      He's the worst kind of techie. He writes code that enables clueless fucks to spam the us.

    4. Re:Rumor has it that Dmitry writes spamming tools by Russ+Nelson · · Score: 2

      Funny how politically unpopular postings are "offtopic" and "trolls". Dmitry works for a company that sells spam tools. He's not a virgin. We can tell, because he's fucked us.
      -russ

      --
      Don't piss off The Angry Economist
  23. Bend over for Bubba, Dmitry! by Anonymous Coward · · Score: -1, Troll


    * g o a t s e x * g o a t s e x * g o a t s e x *
    g g
    o / \ \ / \ o
    a| | \ | | a
    t| `. | | : t
    s` | | \| | s
    e \ | / / \\\ -- \\ : e
    x \ \/ --~~ ~--| \ | x
    * \ \-~ ~-\ | *
    g \ \ .--------.__\| | g
    o \ \_// ((> \ | o
    a \ . C ) _ ((> | / a
    t /\ | C )/ \ (> |/ t
    s / /\| C) | (> / \ s
    e | ( C__)\__/ // / / \ e
    x | \ | \\__// (/ | x
    * | \ \) `---- --' | *
    g | \ \ / / | g
    o | / | | \ | o
    a | | / \ \ | a
    t | / / | | \ |t
    s | / / \/\/ | |s
    e | / / | | | |e
    x | | | | | |x
    * g o a t s e x * g o a t s e x * g o a t s e x *

  24. laws can be illegal by Mdog · · Score: 1

    I agree that what he did was illegal under the terms of the DMCA, but that doesn't mean that he couldn't be found innocent.

    IANAL, but when a law is in contradiction to the constitution, as I and many of you believe the DMCA is, you're innocent (in theory.)

    1. Re:laws can be illegal by Anonymous Coward · · Score: 1, Informative

      And you needn't wait for the legislature to set you free, if the judge fails to do that it is well within the power of any jury to declare the law not valid in the instance of your particular case: http://www.fija.org/

  25. Burning Dmitry by zangdesign · · Score: 2, Informative

    This article on WIRED shows what is probably the general level of concern for most Americans. Especially the final quote.

    --
    To celebrate the occasion of my 1000th post, I will post no more forever on Slashdot. Goodbye.
    1. Re:Burning Dmitry by Pope+Slackman · · Score: 3, Funny

      The "FREE DIMITRY with every purchase" was great.
      Funniest thing I've read today.

      C-X C-S

  26. What did we expect. by BrookHarty · · Score: 1

    What did we expect, For him to plead guilty?

    News seems rather light on the details, how about some urls to transcripts. These 1 line news tidbits isnt cutting it.

  27. I hope he wins by Anonymous Coward · · Score: -1, Troll

    I really hope Sklyarov wins this case. If he ends up in jail, all the assrape is going to make him look like this:


    * g o a t s e x * g o a t s e x * g o a t s e x *
    g g
    o / \ \ / \ o
    a| | \ | | a
    t| `. | | : t
    s` | | \| | s
    e \ | / / \\\ -- \\ : e
    x \ \/ --~~ ~--| \ | x
    * \ \-~ ~-\ | *
    g \ \ .--------.__\| | g
    o \ \_// ((> \ | o
    a \ . C ) _ ((> | / a
    t /\ | C )/ \ (> |/ t
    s / /\| C) | (> / \ s
    e | ( C__)\__/ // / / \ e
    x | \ | \\__// (/ | x
    * | \ \) `---- --' | *
    g | \ \ / / | g
    o | / | | \ | o
    a | | / \ \ | a
    t | / / | | \ |t
    s | / / \/\/ | |s
    e | / / | | | |e
    x | | | | | |x
    * g o a t s e x * g o a t s e x * g o a t s e x *

  28. - STOP RACISM AGAINST ANONYMOUS COWARDS - by Anonymous Coward · · Score: -1, Offtopic


    ..

    ..

    ..

    ..

    ..

    ..

    ..

    ..

    ..

    ..

    ..
    Has anyone noticed that posts by Anonymous Cowards seem to get unfairly moderated down only by the fact that they are being posted anonymously? Surely there would be public outrage if blacks and jews were being unfairly moderated. Has anyone noticed that posts by Anonymous Cowards seem to get unfairly moderated down only by the fact that they are being posted anonymously? Surely there would be public outrage if blacks and jews were being unfairly moderated. Has anyone noticed that posts by Anonymous Cowards seem to get unfairly moderated down only by the fact that they are being posted anonymously? Surely there would be public outrage if blacks and jews were being unfairly moderated. Has anyone noticed that posts by Anonymous Cowards seem to get unfairly moderated down only by the fact that they are being posted anonymously? Surely there would be public outrage if blacks and jews were being unfairly moderated. Has anyone noticed that posts by Anonymous Cowards seem to get unfairly moderated down only by the fact that they are being posted anonymously? Surely there would be public outrage if blacks and jews were being unfairly moderated. Has anyone noticed that posts by Anonymous Cowards seem to get unfairly moderated down only by the fact that they are being posted anonymously? Surely there would be public outrage if blacks and jews were being unfairly moderated. Has anyone noticed that posts by Anonymous Cowards seem to get unfairly moderated down only by the fact that they are being posted anonymously? Surely there would be public outrage if blacks and jews were being unfairly moderated.

  29. law and guilt by Proud+Geek · · Score: 5, Interesting

    Sklyarov is clearly guilty of violating the DMCA. The not guilty plea is stupid nonsense.

    I'm not saying he should be charged or jailed or such. God forbid I support the government's actions here. Thing is, the issue isn't his guilt (as he is clearly guilty) but why the DMCA exists in the first place.

    Don't proclaim Sklyarov's innocence, because he isn't. Instead, proclaim the injustice of a law that imposes draconian punishments for things that should not be illegal in the first place.

    --

    Even Slashdot wants to hide some things

    1. Re:law and guilt by Anonymous Coward · · Score: 0

      No he isn't guilty of violating the DMCA. As far as I know, the DMCA is an American law and although America often resembles a Communist, Socialist, Big-Brother dictatorship, Russia is not a part of America.

    2. Re:law and guilt by furiousgeorge · · Score: 5, Insightful

      Please explain how is is guilty of doing work in another country where this activity isn't illegal? When did the US's jurisdiction become international.

      There's probably fifty things you've done today that are crimes in other countries (read much about Afghanistan lately) - keep things in perspective.

      ALSO - if you plead guilty, then this doesn't go through the courts with the potential result of the DMCA being declared unconstitutional. If everybody pleads guilty there is ZERO chance of the law being struck down.

      Don't be obtuse.

    3. Re:law and guilt by Anonymous Coward · · Score: 0

      Damn, I thought he was innocent till proven guilty.

    4. Re:law and guilt by DA_MAN_DA_MYTH · · Score: 1

      Sklyarov is clearly guilty of violating the DMCA. The not guilty plea is stupid nonsense.


      Why plead guilty? As far as he is concerned he did nothing wrong, and if anything he should be protected by the Constitution under free speech or something of that nature (Although it seems corporations these days have more rights these days than us normal people, the DMCA is just a Jim Crowe law for non-corporations :) ). By pleading not-guilty, he goes to trial to challenge this law. He and Elcomsoft can appeal a decision of them being actually guilty on whether the law is un-constitutional or not. Isn't that how it works? You can't appeal if you plead guilty, am I right?

      Law buffs help me out...
      --
      "It takes many nails to build a crib, but one screw to fill it."
    5. Re:law and guilt by DiningPhilosopher · · Score: 2


      He and his company offered the product for sale in America from a server in Chicago. There's clearly no dispute over jurisdiction. The fact that he's not a citizen and that the work was done elsewhere is irrelevant.

      --
      /* The beatings will continue until morale improves. */
    6. Re:law and guilt by OmegaDan · · Score: 2
      Im not sure how familiar with the US court system you are, but juries (and possibly judges?) can find someone not guilty they object to the law itself. This is called "Jury Nulification".

      IMHO if they pleaded guilty, there would be no trial and the judge would skip directly to sentencing -- thats not a good thing.

    7. Re:law and guilt by Ozric · · Score: 1

      What a bunch of crap. This man is NOT a US Citizen. The law does not apply to him at all. He did not do anything wrong while he was here,
      also you can plead any way you want. I would not plead guilty to anything, if I did it or not. If you do, then you know nothing about the LAW.

    8. Re:law and guilt by Anonymous Coward · · Score: 0

      Do you have ANY idea how the courts in the US work? Apparantly not.

    9. Re:law and guilt by killmenow · · Score: 1

      Sklyarov is clearly guilty of violating the DMCA
      I'm not so sure. What he did was write a program to do something legal in a country where writing it is also legal. You can't break a law that doesn't exist where you are and since the DMCA is not a law in Russia, in writing the application, he did not violate it.

      A case may be made that ElcomSoft violated the DMCA by hosting the site in the US and using a US clearinghouse to process the credit card transactions (the sales transaction occurred in the US) which is a clear violation of the DMCA.

      Selling the application in the US...a violation.
      Writing the application in Russia...NOT a violation.

      The extent to which Skylarov was involved in selling the application is the key to whether HE violated the DMCA or not.
    10. Re:law and guilt by Spotless+Tiger · · Score: 1

      No, he isn't guilty, any more than a visitor to a "coffee shop" in Amsterdam is guilty of committing a drugs offense under US law.

      What Sklyarov does in Russia is between him and the Russian government.

      --
      Racists should be sent back to where they came from
    11. Re:law and guilt by Col.+Panic · · Score: 2

      So he should plead guilty and throw himself on the mercy of the Court? I don't think so. If you plead guilty, you get sentenced. This is an adversarial process - plead your case, man!

    12. Re:law and guilt by NMerriam · · Score: 2

      Sklyarov is clearly guilty of violating the DMCA. The not guilty plea is stupid nonsense

      You're confusing the casual usage of the word "guilty" with the legal use of the word.

      Yes, he violated the DMCA in a literal sense, but that doesn't make him "guilty" in any way (at least until he is convicted by the proper legal process).

      You can kill someone and not be "guilty" of it because it was self-defense. You can kill someone and not be "guilty" of it because you were mentally incapable of understanding the difference between right and wrong.

      The issue here very much is one of guilt -- that's the only reason we take people to criminal court in this country.

      Dmitri is presumably going to claim that he is not guilty of anything because by the Constitution the DMCA itself is not an enforceable law -- thus there is nothing to be guilty of.

      If the DMCA is unconstitutional, legally it is as if it had never existed in the first place (except of course as a legal precedent)-- there will be no such thing as being guilty of violating it.

      --
      Recursive: Adj. See Recursive.
    13. Re:law and guilt by Squirrel+Killer · · Score: 2
      While I heartily agree with your second point, you're wrong on the first. Simply because he's not a US citizen doesn't absolve him of obeying the law while here. A German can't drive 210 mph down I-80 in Chicago just because he could drive 415 kph (or whatever) in Duseldorf.

      -sk

    14. Re:law and guilt by alexjohns · · Score: 2

      It's not quite that simple. He is guilty in some sense - he sold a program (for $99) to Americans that allowed Americans to break the law. If he'd only sold it to Russians, it's unlikely that he'd have been arrested.

      The problem here is coming up with the proper analogy - I don't think there is one. Here's some bad ones:

      Imagine there's a country where pornography depicting 16 year olds is legal. In the US, the legal age is 18. Would it be legal for him to sell it here? (Obviously not.)

      Imagine he's from a country where Marijuana is legal. Is he guilty of a crime if he sells it to an American in the US. (Obviously.)

      You sell a gun to a convicted felon. He's not allowed to own it and you know it. He then kills someone with that gun. Are you guilty of anything? (I believe so.)

      Imagine all our guns had gunlocks. Imagine Dmitry sold a device (legal in Russia) that circumvented the gunlocks. Someone uses his device and subsequently commits a crime with that gun. Is Dmitry liable? (Probably.)

      And that last analogy might be closest - he (his company) knowingly sold something to someone who is not allowed to own it. Like selling alcohol to a minor. You get in trouble for that.

      If he'd just given his crack away, I'm not sure he'd have been prosecutable. But he sold it. Profiting from a crime. However we might feel about the constitutional validity of the DMCA, right now it's a law. Breaking it is a crime.

      I can't wait for the justice department to start arresting all the Dutch tourists on drug charges.

      Oh, and as a naturalized American citizen (ex-German), I'm deeply ashamed. This is not why I came to this country for. I would like to tell all non-American /.ers that we're working to rectify this, but it will take some time. Meanwhile, it would be most helpful if you could convince everyone in your country to go somewhere else for holiday. Some less repressive country. A big drop in the tourist industry would be felt and would help us achieve our goal of returning to a democracy. Thanks for your support. We now return you to your regularly scheduled trolling.

    15. Re:law and guilt by Ms.Taken · · Score: 1

      Actually not all that clear, at least according to "former U.S. Attorney John Gibbons", as quoted in a Time magazine article, which explains the charge this way:

      The charge filed by the government against Sklyarov is confusing enough: it is for "trafficking" software prohibited by the DMCA. This does not mean he went around selling it himself, but rather that Adobe was able to buy it through a third party--and his name was listed on that software's copyright page. Yes, that is as tenuous as it sounds. "I hope the government knows something we don't," says former U.S. Attorney John Gibbons, "because it looks like they haven't done their homework."

    16. Re:law and guilt by Anonymous Coward · · Score: 0

      Sklyarov is clearly guilty of violating the DMCA. The not guilty plea is stupid nonsense.

      Some of us would say that Sklyarov actually broke no law just on the basis of the fact that the DMCA is not a law.

      Some of us would say that the scope of the laws that the U.S. Congress is legally permitted to make into law is limited to a number of clearly defined powers outlined in the constitution, and that if Congress "passes" some law that goes outside that scope, then that law is invalid, null, void, and not legal.

      Some of us would say that there are no laws which violate any of the "congress shall pass no law"s in the bill of rights, that any proclaimed laws which violate those "congress shall pass no law"s are invalid and ficticious, and that the u.s. government does not have the ethical or legal right to enforce such "laws".

      Some of us would say that the DMCA violates the bill of rights, and thus is not a law.

      Some of us would say that Dimitri is guilty of no criminal act.

    17. Re:law and guilt by JCMay · · Score: 1
      I disagree. He's not guilty because the law doesn't apply to him. He didn't do anything wrong in Russia, where he's from. Furthermore, he was not arrested for anything he did while in Las Vegas.


      Taking your argument to its logical conclusion:

      • Germans vacationing here in the Land of the Mouse should be ticketed for speeding since they were obviously going faster (on the German Autobahn) than the 70 MPH speed limit on I-95.
      • Vacationing English would be ticketed for driving "on the wrong side of the road" while in England.
      • Japanese people should be jailed for partaking in the consuption of whale products.


      Why do these things not happen?
    18. Re:law and guilt by Glock27 · · Score: 1
      Sklyarov is clearly guilty of violating the DMCA. The not guilty plea is stupid nonsense.

      You forgot the IANAL, which is massively evident. Sklyarov is almost certainly not guilty, since the DMCA is a US law and Sklyarov lives in a different country with no such law.

      Remember when the author of the Melissa virus wasn't prosecuted? Why was that, again?

      I'm not saying he should be charged or jailed or such. God forbid I support the government's actions here. Thing is, the issue isn't his guilt (as he is clearly guilty) but why the DMCA exists in the first place.

      Don't proclaim Sklyarov's innocence, because he isn't. Instead, proclaim the injustice of a law that imposes draconian punishments for things that should not be illegal in the first place.

      The DMCA should be fought as well...but don't dismiss Sklyarov's innocence so quickly!

      It'll be interesting to see what the courts decide, once they have a chance.

      BTW, IANAL either. ;-)

      186,282 mi/s...not just a good idea, its the law!

      --
      Galileo: "The Earth revolves around the Sun!"
      Score: -1 100% Flamebait
    19. Re:law and guilt by Slak · · Score: 2
      Point 1: Sklyarov wrote a program to defeat Adobe encryption while he was in Russia. This is undisputed. This is also perfectly legal both in Russia (where, apparently, Adobe violated the law by not providing this functionality) and in the States (as he is neither a US national nor on US soil when writing the program). In fact, writing the program is arguably legal according to the DMCA, but the distribution is not.


      Point 2: His employer sold this software (for commercial gain) through a third party that apparently hosted the files on servers in Chicago. This is the *entire* basis of the Government's case. The culpability of Dmitry for the actions of his employer and a third party is certainly a matter of some debate, though I tend to think he should be held harmless. From my understanding, his employer and the third party removed the offending files and remedied the situation.


      Point 3: The fact that he gave a speech about his work at a conference has nothing to do with the case, witness the actual indictment against him (I'm sure www.cryptome.org has a copy). The only bearing that it has on the case, is that he was in the country, which allowed the US's Federal BI to arrest him within its jurisdiction.


      As for calls by Slashdotters for "Jury Nullification" - we (I presume to speak for many Slashdotters) would prefer to see the DMCA struck down completely or substantially rather than see it on the books. Dmitry, apparently, will pay the price for a chance for us to strike down the law. Please contribute to his defense fund and please support the EFF (www.eff.org).

      Of course, there are other causes out there, too. War, genocide and disease in Africa are problems that readily come to mind.

      Cheers,
      Slak

    20. Re:law and guilt by iabervon · · Score: 2

      Actually, it's not entirely clear that the DMCA applies. The DMCA only applies if the copy-protection is "effective", whatever that means. Possibly encrypting the document with a key which is stored in a constant string in a large binary reader is "effective", but using pkzip and then xoring each byte with 102 (IIRC) is very possibly not.

      It's also not clear that Acrobat doesn't circumvent the copy-protection; after all, even after using Dimitry's program, you need a PDF reader. A PDF reader is much much more complicated and difficult to write than xor. It's even more complicated than trying all of the possible bytes to xor with. Since Adobe hasn't even been raided yet, one might guess that what Dimitry did is fine, too.

      The law may be unjust, but it's not so bas as to actually apply to what seems to have happened. After all, I can't sue all US computer companies for breaking my copy-protection method of XORing every byte with 0.

    21. Re:law and guilt by Frums · · Score: 2, Insightful
      The problem with these analogies is that they are all wrong


      Sklyarov wrote the software and the company sold it. So, imagine you are a photographer in a country that allows the sale of porn with 16 year olds. You take pictures and get paid for it. The company sells their magazines in America. You visit america for a conference on risque photography and get arrested.


      -Frums

    22. Re:law and guilt by flatrock · · Score: 2

      The software was sold in the United States. Read the articles.

    23. Re:law and guilt by technos · · Score: 5, Interesting

      If he'd just given his crack away, I'm not sure he'd have been prosecutable. But he sold it. Profiting from a crime. However we might feel about the constitutional validity of the DMCA, right now it's a law. Breaking it is a crime.

      Doesn't matter. This is a criminal action against an employee of ElcomSoft. ElcomSoft paid him to do programming for the eBook processor. He did not place the program on a US server, he did not engage a US company to handle credit card orders, he did not sell the product. He just wrote code.

      Think about it this way; I, in the normal course of my employment, am instructed to make a program to aid the mastering of an inhouse DVD/VCD video product. As part of the program, I write a decryption algo to reduce our pre-mastered DVD discs to plain files so they can me shuffled, re-encoded, etc. The company finds this acceptable, and in fact good enough it thinks it can get some of its partners to use the software for a fee.

      What I did, as a programmer, was legal. Even if I had knowledge that the company may decide to sell it as a commercial product, the burden is on them to acquire the relevant permission. Licensing for sale the CSS IP, the MPEG encoder, etc. Their problem. Not mine. If they are called up on the carpet for IP violations, contributory infringement, DMCA violation, etc, only the company and its officers are legally responsible. Not me.

      Same with ElcomSoft. They are liable if their sale of the product violated law, not DS..

      --
      .sig: Now legally binding!
    24. Re:law and guilt by flatrock · · Score: 2

      The software was sold in the United States, by a distributer in the United States. That means his employer, and possibly he himself, appear to have broken the law in the United States. It isn't even a case of the web site being in Russia and someone downloading the software form there. Read the articles.

    25. Re:law and guilt by r_j_prahad · · Score: 2

      The not guilty plea is stupid nonsense.

      No. The "not guilty" plea is how he gets a trial in the matter. He's perfectly within his rights to do that.

      A guilty plea would have been stupid.

    26. Re:law and guilt by gilroy · · Score: 2
      Blockquoth the poster:

      However we might feel about the constitutional validity of the DMCA, right now it's a law. Breaking it is a crime.

      This is simply not true. If a law is unconstitutional, then it's not a law. It cannot be enforced. Of course, the DMCA has not (yet) been found unconstitutional, so people can be prosecuted under it. But if Sklyvarov and his attorneys hold that the DMCA is unconstitutional, then his plea of "not guilty" is perfectly valid because -- from his viewpoint -- he did not break any law.
    27. Re:law and guilt by Lumpy · · Score: 2

      Therefore you are guilty of a myriad of things. If I was to canvas all laws from the entire world I should be albe to come up with a reason to imprision/punish/physically harm/or even be-head anyone I walk up to today.

      your point of view is very flawed, as badly as every United states law passed in the past 10 years.

      --
      Do not look at laser with remaining good eye.
    28. Re:law and guilt by MrGrendel · · Score: 2

      If he does not plead "not guilty," he cannot excercise his right to a trial and, probably more importantly in this case, appeals. If the DMCA is found to be unconstitutional on free speech grounds, then he is indeed not guilty because the law was invalid in the first place. And even if it is an enforcable law, it is still not clear that he is guilty because of jurisdictional issues (and the additional problem of holding an individual liable if the corporation owns the copyright on his software).

    29. Re:law and guilt by avdp · · Score: 2

      Hmmm... No.

      He is indeed innocent of what he is charge for. The actual writing of the code was done in Russia, where the US has no jurisdiction. The US recognizes that (presumably) and they're not charging him for anything of that sort. What they're charging him for is trafficing the code since apparently they used a web host and payment processing service that's based in the US. OK, well, isn't it Elmosoft and Elmosoft only that's responsible? Since when are employees responsible for the misdeeds of their employers? This is like getting sued because your employers poluted some river somewhere (sorry for the analogy, but I work for a Steel company...)

      That being said, I don't even believe in the charges at all (and needless to say I don't believe in the DMCA). It looks to me that the US would have charged him even if it wasn't hosted in the US. They'd probably figured out a way to prove that the internet traffic between the host and the person downloading passed through a cable that goes through some Guam airforce base that's American sovereignty. These charges are just a loophole they found to try to enforce a law makes no sense.

    30. Re:law and guilt by rking · · Score: 1

      The software was sold in the United States. Read the articles.

      But NOT by Dmitri Sklyarov.

      Suppose you work for a computer games company. You produce a game that is perfectly legal to produce and sell in the country that you live in. It is then sold by your employers, and by people who buy it from your employers. Some of those sales are over the internet.

      Somewhere in the world it is illegal (or might be illegal, there hasn't been a test case on the new anti-violent computer games law yet) and it can be purchased from there.

      In this situtation, should you, the author, be subject to imprisonment? I can understand the prosecution of whoever is selling it over the internet, though it does cause problems, but I don't understand the idea that there is a basis for prosecuting the author, who did nothing illegal in the jurisdiction in which they acted.

    31. Re:law and guilt by jazman_777 · · Score: 1
      Please explain how is is guilty of doing work in another country where this activity isn't illegal? When did the US's jurisdiction become international.


      It really started in 1898, with the Spanish-American war, when we began acting as the world's Most Righteous, Holy, and Benevolent Policeman.

      --
      Slashdot: Failed Car Analogies. Amateur Lawyering. Anecdote Battles.
    32. Re:law and guilt by flatrock · · Score: 2

      Selling the application in the US...a violation.

      So why is Sklyarov not at least partially, legally responsible for this action? He works for the company. His pay derived from the creation of the software. He represented that company and that software at a conference. Just because there's some company involved doesn't absolve him of his personal responsibility to obey the law. If the law was truely broken (this is for the court to decide) in the US, then unless he had no idea it would be sold in the US (also for a court to decide), then he broke it.

      I still think it's a bad law, and should be tossed out by the courts as unconstitutional, but I'm not so sure he didn't break the law.

      The extent to which Skylarov was involved in selling the application is the key to whether HE violated the DMCA or not.

      Oops, I thought this last line was your sig, and didn't read it until I wrote the rest of your post. I guess my point with this post is that a lot of people are screaming that the US is overstepping it's bounds, but when a foreign company is selling their products to people in the US, the US definately has the right to enforce it's laws. If you don't like it, stay out of the US, and make sure you don't have any business interests here.

    33. Re:law and guilt by Anonymous Coward · · Score: 0

      Under United States Jurisdprudence you are Innocent until proven guilty in a court of law.

      He's innocent (AND he didn't do it).

    34. Re:law and guilt by rking · · Score: 1

      The software was sold in the United States, by a distributer in the United States. That means his employer, and possibly he himself, appear to have broken the law in the United States.

      It means that the distributer appears to have broken a law in the United States. Are they even being indicted?

      I can see how Elcomsoft's use of that distributor could in turn be seen as them acting illegally in the United States. Where do you get "possibly he himself" from though? And do you think that "possibly" should be enough to get someone into a prison cell, even on a temporary basis? It's possible that you've committed any number of crimes, I'd hope there's at least some evidence that YOU have done before you get handcuffed and marched away.

    35. Re:law and guilt by Anonymous Coward · · Score: 0

      Now imagine you helped set up a US mainland server , FTPd the pics into the US, and sold a password to a fed in california.

      that's more like it.

    36. Re:law and guilt by Anonymous Coward · · Score: 0
      But NOT by Dmitri Sklyarov.

      How do you know? Besides, if you murder someone under company orders you can't hide behind your employer. Why do you think that working as a company representative absolves him of responsibility?

    37. Re:law and guilt by Xerithane · · Score: 2
      Your analogies are absolutely flawed because AEBPR's intent is not to allow people to break the law. That isn't why it was written and that wasn't why it was published.


      It's a competitor to Adobe. It reads ebooks and exports PDF's. Free market, right? Nope, Adobe doesn't like competition.


      His software has legal purposes too. Yes, it has illegal purposes but it's more analogous to someone manufacturing a gun in Russia and selling it in America. Oh wait! You can kill someone with this gun! We better arrest this guy because Smith&Wesson informed us that it exists and he's coming into town to give a speech on How to build hunting rifles for maximum damage.


      I think it's very important for individuals to understand exactly why the DMCA is flawed and who it is there to benefit. It's not there to prohibit illegal software, it's there to prohibit competition that is unlicensed. But who's going to license their technology out to a competitor? Not Adobe, apparently.

      --
      Dacels Jewelers can't be trusted.
    38. Re:law and guilt by Anonymous Coward · · Score: 0
      Suppose you work for a computer games company. You produce a game that is perfectly legal to produce and sell in the country that you live in. It is then sold by your employers, and by people who buy it from your employers. Some of those sales are over the internet.
      Anyone know if John Carmack has ever been to Germany? I recall reading somewhere that Quake was banned in that country.
    39. Re:law and guilt by Anonymous Coward · · Score: 0

      I'm sure there are tons of things that I would be guilty of in Afghanistan... that's why I don't go there!

    40. Re:law and guilt by rking · · Score: 1

      How do you know? Besides, if you murder someone under company orders you can't hide behind your employer.

      Of course not. But if your employer goes out and murders someone then that does not make you guilty of murder unless you were actually involved in the murder. That's the point. Dmitry didn't sell the software in the USA. He doesn't need to "hide" behind his employer. The people who did distribute the software might well be guilty of a crime, that doesn't mean that Dmitry, who did not sell the software in the USA, is.

      Why do you think that working as a company representative absolves him of responsibility?

      It doesn't. Why do you think that working for a company makes him responsible for the acts of other people working for that company who do not answer to him?

    41. Re:law and guilt by Wah · · Score: 2

      It really started in 1898, with the Spanish-American war,

      Don't you mean the Cuban War for Independence? Or do ya think the English call it the "Revolutionary War" too? ;-)

      --
      +&x
    42. Re:law and guilt by Anonymous Coward · · Score: 0

      "This is a criminal action against an employee of ElcomSoft. ElcomSoft paid him to do programming for the eBook processor."

      I thought the government complaint said that the software was (C) Sklyarov. That wouldn't be normal in a work-for-hire situation, although I fully admit to knowing nothing about Russian copyright laws.

    43. Re:law and guilt by MrBogus · · Score: 2

      The DMCA defines what they mean by "effective" copy-protection. It doesn't require strong encryption, just that the user effectively wouldn't be able to copy the content without using a device to bypass the protection.

      For example, it was silly when MS tried to raise the DMCA against slashdot because they had password-protected a zip file. Turns out that asking for a password is an optional client feature of zip, not effective content protection. The same is not true for eBooks.

      --

      When I hear the word 'innovation', I reach for my pistol.
    44. Re:law and guilt by Anonymous Coward · · Score: 0
      That's the point. Dmitry didn't sell the software in the USA...Dmitry, who did not sell the software in the USA,..

      as I noted in this thread:

      11. as part of the conspiracy, and to further the objects therof, the defendents committed the following overt acts in the Norther District of California:

      a. Beginning on or about June 20, 2001, the defendants offered the Advanced eBook Processor for sale in San Jose, California, and elsewhere, on the elcomsoft.com website
      b. On or about June 26, 2001, the defendants caused a purchaser in California to send a payment of approximately $99 to RegNow; and
      c. On or about June 26, 2001, the defendants sent registration key for a copy of the AEBPR program to an individual purchaser in San Jose, California, who had made a payment of approximately $99 to RegNow,
      All in violation of Title 18, United States Code, Section 371

      (Note "the defendants" are expressly listed in this count as both Dmitri and Elcomsoft.)

    45. Re:law and guilt by Tetsujin28 · · Score: 2

      Well said.

      A plea of "not guilty" might be better understood as a plea of "Oh yeah? Prove it."

      --
      - - - -
      The real Tetsujin 28 is a giant robot.
    46. Re:law and guilt by ryanwright · · Score: 2

      isn't it Elmosoft and Elmosoft only that's responsible?

      Elmosoft? As in "Tickle Me Elmosoft?"

      --
      -Ryan, with the unoriginal sig
    47. Re:law and guilt by rjh · · Score: 2
      Please learn what law is before you go about talking about words like ``guilt''. Let the first lesson commence.

      1. You can only break a law which exists.
        If there's no law against eating peanut butter and jelly sandwiches on Thursdays, then you can't be guilty of committing the crime of eating peanut butter and jelly sandwiches on Thursdays, can you?
      2. Unconstitutional laws do not exist.
        This is a cute little piece of judicial fiction, but it makes sense once you think about it. If unconstitutional laws were just simply voided, then that would be an acknowledgment that at one point they possessed legitimacy. Unconstitutional laws never possess legitimacy in the eyes of the court; as soon as the court formally finds that a law is unconstitutional, that law is nullified ab initio, from the very beginning. The law was, in essence, never passed in the first place. It couldn't be passed--because Congress only has the authority to pass laws which are in accordance with the Constitution.
      3. Dmitry may believe the DMCA is unconstitutional.
        God knows I do. Since unconstitutional laws don't exist--see the above point--Dmitry cannot be guilty of breaking an unconstitutional law--see the first point.
      ... So please don't say another word about how ``he's clearly guilty of violating the DMCA''. He's not. He's only guilty of violating the DMCA if the DMCA is Constitutional. That's a matter for the court to decide.

      Did he violate the DMCA? Certainly. Congress is free to say anything they like, including free to say people shouldn't eat peanut butter and jelly sandwiches on Thursdays.

      Is he guilty of violating the DMCA? That's a far different question. Am I guilty if I eat a peanut butter and jelly sandwich on a Thursday? Only if there's a law which forbids it--and since there's no law, I'm not guilty of a damn thing.
    48. Re:law and guilt by avdp · · Score: 2

      Oops! Well, that's what it always sounded to me :)

    49. Re:law and guilt by metachimp · · Score: 1
      How to build hunting rifles for maximum damage


      Silly goose, they don't build hunting rifles for maximum damage, they build cartridges for maximum damage, and if you're hunting, you can't do too much damage. That's why we don't use RPG's to hunt Elk.

      --
      The system has failed you, don't fail yourself. --Billy Bragg
    50. Re:law and guilt by Anonymous Coward · · Score: 0

      caserole dick

    51. Re:law and guilt by Anonymous Coward · · Score: 0
      two points i want to make. they are only partially related to the parent post, but i'm making them here because this one is better-written and more coherent than some of the others.

      first, the reason that sklyarov was arrested -- as opposed to the charges being brought solely against elcomsoft -- was that apparently the splash screen of the copy of AEBPR adobe purchased with the FBI looking on had sklyarov's name as the author/copyright holder of the program, not elcomsoft. the us attorney is using that fact as justification for arresting him. apparently the splash screen was subsequently changed to say 'copyright elcomsoft' or something along those lines, but for the purposes of the indictment that was too late. (at least software authors can learn a valuable lesson from this: unless you have something very specific to gain from claiming individual authorship of a piece of code you've written, it is probably safer to put your company's name on the credit page, not your own.)

      second, i'm curious about the idea that the AEBPR software falls under one of the exemptions listed in section 1201 -- either the encryption research exemption or the interoperability exemption. if i were making the case in court, i'd probably emphasize the latter, as the program allows the documents to be used on many platforms not supported by adobe's reader. of course, because there is no legal precedent concerning the effective application of these exemptions in practice, the us attorney can proceed full speed ahead. honestly, i'm not to sure they wouldn't have proceeded even if there had been some legal precedent, but that's another story.

      what do you think?

    52. Re:law and guilt by hearingaid · · Score: 2

      for a few weeks.

      the fact that he's not a citizen goes to intent. and since these are criminal proceedings, intent is not only relevant, it's crucial to the prosecution's case. they're going to have to argue that he should have been aware that he was violating the DMCA. it's pretty obvious that he was not, in fact, aware.

      the actions of his employer are also totally irrelevant. Elcomsoft isn't on trial. (And yes, before you exclaim in horror, it can be. Criminal prosecutions against corporations do happen: there's no jail term, of course, but fines can be inflicted.)

      the company in the United States had a contract with Elcomsoft. now, in order for the prosecution to get him, they're not only going to have to show he ought to have known about the DMCA, but that he either knew or ought to have known about the arrangements to important the Advanced eBook Processor into the United States.

      Guys, these are criminal proceedings. This isn't like the MPAA vs. 2600. The state has a much, much higher standard that it has to meet than private individuals do. All Dmitry needs is reasonable doubt.

      --

      my old sig used to be funny, but then slashcode ate it and now it's not funny anymore

    53. Re:law and guilt by hearingaid · · Score: 2

      judges can't. they have to submit written reasons for their decisions, and "I don't like this law" is an easy route to appeal.

      juries, however, have a de facto ability to nullify laws they dislike, by finding against the undesirable law. whether this ability is legal or not is the subject of much debate among legal scholars; it's pointless of course since the only way to take this power away is to make juries submit written reasons, and that'll never happen. :)

      --

      my old sig used to be funny, but then slashcode ate it and now it's not funny anymore

    54. Re:law and guilt by Temkin · · Score: 1

      Sklyarov is clearly guilty of violating the DMCA. The not guilty plea is stupid nonsense.



      Jeez... If you're a US citizen, you obviously didn't learn anything in civics. If he pleads guilty, it's game over, and off to jail after a brief sentancing hearing. In order to make any kind of defense, including a constitutional challenge defense, he must plead not guilty. All the not guilty plea means is he wants to fight it out in court.



      Don't proclaim Sklyarov's innocence, because he isn't. Instead, proclaim the injustice of a law that imposes draconian punishments for things that should not be illegal in the first place.



      Again, you don't seem to understand how US law works. Congress passed the DMCA, and it was signed into law by then president Clinton. The US system of checks and balances allows judicial review. If the law is found to violate some provision of the constitution, something a law isn't allowed to do, then the judiciary may declare the law null and void. An unconstitutional law is no law at all. If the DMCA is found to be unconstitutional, Sklyarov will be guilty of nothing. But in order to get that review, he needs to plead not guilty, and fight it out.


      Temkin


    55. Re:law and guilt by AntiNorm · · Score: 2

      The DMCA only applies if the copy-protection is "effective", whatever that means. Possibly encrypting the document with a key which is stored in a constant string in a large binary reader is "effective", but using pkzip and then xoring each byte with 102 (IIRC) is very possibly not.

      It applies to CSS though...

      --

      I pledge allegiance to the flag...
      of the Corporate States of America...
    56. Re:law and guilt by dachshund · · Score: 2

      If the US were accusing him of complicity in distributing the thing, then they might have a case. But the fact is, he's accused of creating it. It'll be fairly easy to demonstrate that he did not create it with the express intention of selling it in the USA, so there's not much there for the DOJ to accuse him of, following your argument.

    57. Re:law and guilt by jazman_777 · · Score: 1
      Don't you mean the Cuban War for Independence [historyofcuba.com]? Or do ya think the English call it the "Revolutionary War" too? ;-)


      The whole "Cuban War for Independence" was a fiasco for....the Filipinos. We helped Cuba, all moralistic and all, throw off the Spanish yoke. The Filipinos thought, "now's our chance to throw off the yoke, too!" We suppressed their independence movement, to the tune of 200,000 dead Filipinos. Our real goal was commercial agitation for opening the markets to China--we had hit the western frontier limit, and people were afraid that without new expanding markets, the US economy would flatten and stagnate. And a key element in the China market was the availability of coaling stations for sailing ships. The Philippines were unfortunately an optimal location. So was Hawaii, whose monarchy we subverted and overthrew.

      --
      Slashdot: Failed Car Analogies. Amateur Lawyering. Anecdote Battles.
    58. Re:law and guilt by thogard · · Score: 1

      But whare the the chances of Sklyarov getting a jury trial with "peers"? the court system is so aginst smart people in the jury that it won't happen. From what I can tell, about the only time technical people get on jurys is when they are the last on the list and everyone else has been refused for some reason.

    59. Re:law and guilt by doug363 · · Score: 1

      You make a good point. I'd like to add to this: a verdict of "not guilty" does not mean the same as "innocent". "Not guilty" means that the judge/jury did not want to pronounce the defendant. It does not mean total (or even partial) innocence.

    60. Re:law and guilt by doug363 · · Score: 1

      Sorry...
      That should be "...pronounce the defendant guilty". There.

    61. Re:law and guilt by Troed · · Score: 1
      ZIP encryption is 3 times 2^32 bits secure. It is not "optional".


      There are programs that can hack am encrypted ZIP file in a few minutes, but you need at least 13 (or around that) bytes of _known_ plaintext together with those same bytes inflated/etc with the same method as used inside the .zip file.


      Effectively, ZIP encryption is _more_ secure than CSS, as an example.

    62. Re:law and guilt by Anonymous Coward · · Score: 0

      I certainly don't support the legal interpretation that a programmer can be held responsible for writing something for his employer in a different country, where it is legal.

      As for speaking at the conference (speaking, not distributing the program), that is most obviously something that should not be censored under any circumstances.

      The charges, as far as I understand them, referred to the former rather than the latter act.

    63. Re:law and guilt by hearingaid · · Score: 2

      this is quite correct. the other reason why technical people don't get on juries, by and large, is that there aren't very many of us. statistically the odds are against it.

      --

      my old sig used to be funny, but then slashcode ate it and now it's not funny anymore

    64. Re:law and guilt by Xerithane · · Score: 1
      That actually was my point. The obvious use would be big game and/or illegal activities. Poaching, ie, a bear rifle.


      And some of us do use RPG's for Elk. What do you think all those hillbillies who win the lottery do with their money? :)

      --
      Dacels Jewelers can't be trusted.
    65. Re:law and guilt by DiningPhilosopher · · Score: 2


      I never said he was guilty, I said he won't get off by claiming that the US has no jurisdiction over the actions of people who are not citizens. You don't seem to disagree.

      --
      /* The beatings will continue until morale improves. */
  30. KTB's insights make me wanna by Anonymous Coward · · Score: -1, Flamebait
    +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+
    * \ \ \ *
    j / \ \ j
    a \ \ a
    c \ \ c
    k / \ \ \/,,..---v--. k
    o ,,\.--"""\/ \ o
    f \ > f
    f / f
    * /vvv\..---""'`-' *
    j ,,. j
    a / \ \hhh/ a
    c c
    k k
    o \ \ o
    f \ \/ f
    f \ f
    * \ *
    j j
    a a
    c c
    k k
    o o
    f f
    f f
    * *
    +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+
    portant Stuff: * Please try to keep posts on topic. * Try to reply to other people comments instead of starting new threads. * Read other people's messages before posting your own to avoid simply duplicating what has already been said. * Use a clear subject that describes what your message is about. * Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page) Problems regarding accounts or comment posting should be sent to CowboyNeal. Linux - Das System fuer schlaue Maedchen ;) -- banshee All trademarks and copyrights on this page are owned by their respective owners. Comments are owned by the Poster. The Rest © 1997-2001 OSDN.

  31. no reg link by cha0sadddddddd · · Score: 1

    http://archive.nytimes.com/2001/08/31/technology/3 1HACK.html

    --
    Collecting data is only the first step toward wisdom. But sharing data is the first step toward community
    1. Re:no reg link by cha0sadddddddd · · Score: 1

      sorry no space
      http://archive.nytimes.com/2001/08/31/technology /3 1HACK.html
      that one works

      --
      Collecting data is only the first step toward wisdom. But sharing data is the first step toward community
  32. Fenris Wolf? by sabinm · · Score: 1
    This sounds to me like a bit of corporate canibalism. A company that chases after hackers getting arrested for hacking. Not that I denounce Skylarov, but after reading that statement from Elmcosoft, I can't pity them too much.

    --
    http://cincyboys.blogspot.com/ Everything Cincinnati. Including the word 'Finnih'
  33. A Response from Russia by kjj · · Score: 5, Informative

    The Russian Foreign Ministry is warning programmers not to go to the US or they could be arrested. Check out the story here.

    1. Re:A Response from Russia by NullPointer · · Score: 3, Informative

      There is also a story at the NYTimes Russians Deem Arrest Insult to Their Industry that has some interviews with other Russian programmers and their take on the whole mess.

      --
      NULL
    2. Re:A Response from Russia by VP · · Score: 1

      Here is the original from the Russian ministry of Foreign Affairs. Translation to come later.

    3. Re:A Response from Russia by neowintermute · · Score: 1

      this whole thing just illustrates how america is totally run by large corporations. capitalism and democracy are incompatible.

    4. Re:A Response from Russia by Anonymous Coward · · Score: 0

      he he good propaganda for bolcheviks

  34. He he he... by Anonymous Coward · · Score: -1, Troll

    I like the DMCA!

    180507 I enjoy spamming Slashdot using Tcl! 28744 58361 22398

    54055 I enjoy spamming Slashdot using Tcl! 96452 187749 201946

    211763 I enjoy spamming Slashdot using Tcl! 73920 103057 34934

    11391 I enjoy spamming Slashdot using Tcl! 87868 129724 97362

    20299 I enjoy spamming Slashdot using Tcl! 126775 195753 230830

    123287 I enjoy spamming Slashdot using Tcl! 170484 116821 216458

    118755 I enjoy spamming Slashdot using Tcl! 8752 36929 137766

    3823 I enjoy spamming Slashdot using Tcl! 148460 91437 199234

    181691 I enjoy spamming Slashdot using Tcl! 76968 225625 542

    191559 I enjoy spamming Slashdot using Tcl! 180196 168773 65850

    160147 I enjoy spamming Slashdot using Tcl! 83744 30320 29398

    75935 I enjoy spamming Slashdot using Tcl! 182172 118429 9266

    152043 I enjoy spamming Slashdot using Tcl! 57880 214217 37134

    178231 I enjoy spamming Slashdot using Tcl! 88148 167925 110122

    194819 I enjoy spamming Slashdot using Tcl! 175056 184033 164870

    155727 I enjoy spamming Slashdot using Tcl! 30604 95501 207138

    213595 I enjoy spamming Slashdot using Tcl! 83912 193209 130366

    227303 I enjoy spamming Slashdot using Tcl! 211140 111397 156314

    124851 I enjoy spamming Slashdot using Tcl! 20608 201425 31542

    188479 I enjoy spamming Slashdot using Tcl! 226556 28413 12370

    95627 I enjoy spamming Slashdot using Tcl! 212664 56041 139118

    214935 I enjoy spamming Slashdot using Tcl! 183412 220949 132426

    25123 I enjoy spamming Slashdot using Tcl! 205040 62337 144934

    188591 I enjoy spamming Slashdot using Tcl! 101868 173485 35522

    114939 I enjoy spamming Slashdot using Tcl! 207976 76313 198750

    112327 I enjoy spamming Slashdot using Tcl! 174884 217221 217018

    195155 I enjoy spamming Slashdot using Tcl! 34272 152689 1046

    213663 I enjoy spamming Slashdot using Tcl! 16540 156317 152754

    139051 I enjoy spamming Slashdot using Tcl! 58328 182025 150862

    37559 I enjoy spamming Slashdot using Tcl! 165396 149173 191210

    200067 I enjoy spamming Slashdot using Tcl! 231184 100705 87302

    230799 I enjoy spamming Slashdot using Tcl! 68236 190733 195810

    61147 I enjoy spamming Slashdot using Tcl! 40904 17721 176638

    201575 I enjoy spamming Slashdot using Tcl! 27012 45349 70106

    87603 I enjoy spamming Slashdot using Tcl! 231040 161041 758

    101055 I enjoy spamming Slashdot using Tcl! 76732 130108 169746

    17803 I enjoy spamming Slashdot using Tcl! 6200 95337 81454

    192791 I enjoy spamming Slashdot using Tcl! 208308 131605 87242

    139299 I enjoy spamming Slashdot using Tcl! 32176 20033 218790

    113647 I enjoy spamming Slashdot using Tcl! 88364 77421 6658

    156155 I enjoy spamming Slashdot using Tcl! 45672 41689 87326

    220743 I enjoy spamming Slashdot using Tcl! 82660 212357 233274

    177555 I enjoy spamming Slashdot using Tcl! 99232 150449 162006

    111583 I enjoy spamming Slashdot using Tcl! 20060 3357 13234

    200171 I enjoy spamming Slashdot using Tcl! 32087 134665 88142

    112119 I enjoy spamming Slashdot using Tcl! 106516 14453 107370

    25987 I enjoy spamming Slashdot using Tcl! 76304 115041 223558

    137615 I enjoy spamming Slashdot using Tcl! 232332 47373 232930

    10651 I enjoy spamming Slashdot using Tcl! 203528 229305 169342

    225959 I enjoy spamming Slashdot using Tcl! 74436 3493 111770

    126387 I enjoy spamming Slashdot using Tcl! 76864 191441 15798

    20095 I enjoy spamming Slashdot using Tcl! 95612 73149 163666

    154763 I enjoy spamming Slashdot using Tcl! 162360 138217 232814

    98135 I enjoy spamming Slashdot using Tcl! 211572 163669 182666

    47523 I enjoy spamming Slashdot using Tcl! 228400 150017 109734

    85231 I enjoy spamming Slashdot using Tcl! 97388 28845 64642

    121979 I enjoy spamming Slashdot using Tcl! 135336 30553 87710

    59846 I enjoy spamming Slashdot using Tcl! 80164 91781 132858

    77395 I enjoy spamming Slashdot using Tcl! 231392 169073 56790

    107167 I enjoy spamming Slashdot using Tcl! 4124 148701 178

    71915 I enjoy spamming Slashdot using Tcl! 116952 35209 3086

    58743 I enjoy spamming Slashdot using Tcl! 76180 128117 71274

    220291 I enjoy spamming Slashdot using Tcl! 77648 18465 98182

    182159 I enjoy spamming Slashdot using Tcl! 230796 40333 72290

    105627 I enjoy spamming Slashdot using Tcl! 143944 78521 206718

    39655 I enjoy spamming Slashdot using Tcl! 64772 164709 57946

    128242 I enjoy spamming Slashdot using Tcl! 76800 62737 132854

    40191 I enjoy spamming Slashdot using Tcl! 151228 175805 152082

    187339 I enjoy spamming Slashdot using Tcl! 121015 43113 34990

    65687 I enjoy spamming Slashdot using Tcl! 43764 24661 107018

    17955 I enjoy spamming Slashdot using Tcl! 20272 108929 62886

    119023 I enjoy spamming Slashdot using Tcl! 168620 42477 184834

    150011 I enjoy spamming Slashdot using Tcl! 53928 81625 150302

    194439 I enjoy spamming Slashdot using Tcl! 139876 33413 94650

    223507 I enjoy spamming Slashdot using Tcl! 129823 85041 196438

    70175 I enjoy spamming Slashdot using Tcl! 29532 155869 184946

    25323 I enjoy spamming Slashdot using Tcl! 199000 104777 169614

    189751 I enjoy spamming Slashdot using Tcl! 160148 93045 225322

    214979 I enjoy spamming Slashdot using Tcl! 126096 169633 133190

    132687 I enjoy spamming Slashdot using Tcl! 119884 11981 210018

    173275 I enjoy spamming Slashdot using Tcl! 181832 222009 193726

    40103 I enjoy spamming Slashdot using Tcl! 32580 45157 150554

    205491 I enjoy spamming Slashdot using Tcl! 58048 143825 138102

    96319 I enjoy spamming Slashdot using Tcl! 117116 160893 23890

    167627 I enjoy spamming Slashdot using Tcl! 137784 171241 159278

    165975 I enjoy spamming Slashdot using Tcl! 169012 189269 109386

    114403 I enjoy spamming Slashdot using Tcl! 121520 65217 104614

    53231 I enjoy spamming Slashdot using Tcl! 130668 3565 81602

    169659 I enjoy spamming Slashdot using Tcl! 141736 70553 46110

    149767 I enjoy spamming Slashdot using Tcl! 117283 90501 124858

    85715 I enjoy spamming Slashdot using Tcl! 166752 164209 73046

    138783 I enjoy spamming Slashdot using Tcl! 131740 176477 103794

    124650 I enjoy spamming Slashdot using Tcl! 26648 158985 6862

    187319 I enjoy spamming Slashdot using Tcl! 168276 108853 55850

    228867 I enjoy spamming Slashdot using Tcl! 61264 196001 204678

    194575 I enjoy spamming Slashdot using Tcl! 5132 192909 139426

    47003 I enjoy spamming Slashdot using Tcl! 57480 226297 185534

    128871 I enjoy spamming Slashdot using Tcl! 85828 51365 37722

    48499 I enjoy spamming Slashdot using Tcl! 208256 114513 211510

    53567 I enjoy spamming Slashdot using Tcl! 223164 205501 151058

    227595 I enjoy spamming Slashdot using Tcl! 127672 131369 225006

    75223 I enjoy spamming Slashdot using Tcl! 91700 79317 145354

    129250 I enjoy spamming Slashdot using Tcl! 121008 201985 107942

    213999 I enjoy spamming Slashdot using Tcl! 109036 124973 222210

    196987 I enjoy spamming Slashdot using Tcl! 44264 9561 96478

    196295 I enjoy spamming Slashdot using Tcl! 139812 137989 211706

    10323 I enjoy spamming Slashdot using Tcl! 185440 187697 184854

    102751 I enjoy spamming Slashdot using Tcl! 221468 60765 220402

    176939 I enjoy spamming Slashdot using Tcl! 201816 169033 151310

    5367 I enjoy spamming Slashdot using Tcl! 45844 8501 35178

    181315 I enjoy spamming Slashdot using Tcl! 78992 155169 206086

    226703 I enjoy spamming Slashdot using Tcl! 229260 217357 82274

    121370 I enjoy spamming Slashdot using Tcl! 79048 209465 161982

    121639 I enjoy spamming Slashdot using Tcl! 5636 215013 209050

    34547 I enjoy spamming Slashdot using Tcl! 144384 205201 160118

    47295 I enjoy spamming Slashdot using Tcl! 207292 12989 20946

    79243 I enjoy spamming Slashdot using Tcl! 156920 162537 151534

    222551 I enjoy spamming Slashdot using Tcl! 102708 54805 73802

    171939 I enjoy spamming Slashdot using Tcl! 119536 41153 870

    209647 I enjoy spamming Slashdot using Tcl! 221804 153261 189058

    13115 I enjoy spamming Slashdot using Tcl! 26472 154969 212126

    184263 I enjoy spamming Slashdot using Tcl! 204580 216197 23994

    201811 I enjoy spamming Slashdot using Tcl! 122528 109425 10582

    28319 I enjoy spamming Slashdot using Tcl! 71196 194653 30769

    6507 I enjoy spamming Slashdot using Tcl! 151384 227081 12558

    211255 I enjoy spamming Slashdot using Tcl! 14612 186549 4906

    190403 I enjoy spamming Slashdot using Tcl! 159120 96097 151814

    27471 I enjoy spamming Slashdot using Tcl! 115468 229325 122081

    160219 I enjoy spamming Slashdot using Tcl! 53576 73593 94270

    188327 I enjoy spamming Slashdot using Tcl! 212484 14821 30937

    169395 I enjoy spamming Slashdot using Tcl! 19072 145169 41526

    204223 I enjoy spamming Slashdot using Tcl! 161660 159357 200914

    177611 I enjoy spamming Slashdot using Tcl! 153528 106345 56942

    121239 I enjoy spamming Slashdot using Tcl! 17716 130132 159690

    32226 I enjoy spamming Slashdot using Tcl! 27824 132801 13798

    80495 I enjoy spamming Slashdot using Tcl! 137772 59629 152066

    38523 I enjoy spamming Slashdot using Tcl! 33640 106457 165534

    33031 I enjoy spamming Slashdot using Tcl! 40868 149445 155002

    52499 I enjoy spamming Slashdot using Tcl! 87456 30192 5270

    76767 I enjoy spamming Slashdot using Tcl! 222364 229661 214578

    128875 I enjoy spamming Slashdot using Tcl! 123031 131529 80206

    15862 I enjoy spamming Slashdot using Tcl! 158100 173557 5354

    158211 I enjoy spamming Slashdot using Tcl! 39568 188705 229062

    8719 I enjoy spamming Slashdot using Tcl! 196556 1293 178210

    126107 I enjoy spamming Slashdot using Tcl! 38664 178681 74558

    205095 I enjoy spamming Slashdot using Tcl! 107332 139109 131226

    61363 I enjoy spamming Slashdot using Tcl! 183680 147537 137974

    72191 I enjoy spamming Slashdot using Tcl! 117948 201085 135122

    139659 I enjoy spamming Slashdot using Tcl! 114616 3113 76590

    209047 I enjoy spamming Slashdot using Tcl! 6644 25941 115018

    9635 I enjoy spamming Slashdot using Tcl! 84912 163009 109286

    117423 I enjoy spamming Slashdot using Tcl! 216940 169517 220674

    140731 I enjoy spamming Slashdot using Tcl! 54248 25305 31582

    93959 I enjoy spamming Slashdot using Tcl! 95076 219973 152570

    60627 I enjoy spamming Slashdot using Tcl! 103264 94001 19158

    11935 I enjoy spamming Slashdot using Tcl! 15452 67869 43186

    14123 I enjoy spamming Slashdot using Tcl! 70680 60936 187214

    124791 I enjoy spamming Slashdot using Tcl! 162388 165365 94122

    211459 I enjoy spamming Slashdot using Tcl! 45776 75873 72070

    158927 I enjoy spamming Slashdot using Tcl! 167244 74701 135458

    232155 I enjoy spamming Slashdot using Tcl! 34056 9913 104510

    19047 I enjoy spamming Slashdot using Tcl! 145924 65381 230298

    74035 I enjoy spamming Slashdot using Tcl! 6272 65169 124725

    24383 I enjoy spamming Slashdot using Tcl! 87420 161917 216914

    160971 I enjoy spamming Slashdot using Tcl! 49528 214505 149742

    118039 I enjoy spamming Slashdot using Tcl! 114356 150933 231370

    197731 I enjoy spamming Slashdot using Tcl! 199088 223425 66982

    191279 I enjoy spamming Slashdot using Tcl! 141996 156013 124609

    111867 I enjoy spamming Slashdot using Tcl! 95464 96281 230238

    215815 I enjoy spamming Slashdot using Tcl! 203492 127749 147706

    76883 I enjoy spamming Slashdot using Tcl! 134880 221617 46934

    115551 I enjoy spamming Slashdot using Tcl! 68188 210845 166962

    17899 I enjoy spamming Slashdot using Tcl! 199256 153033 167950

    109367 I enjoy spamming Slashdot using Tcl! 170964 148981 38378

    84675 I enjoy spamming Slashdot using Tcl! 58192 83489 224646

    226063 I enjoy spamming Slashdot using Tcl! 108620 221517 49954

    210971 I enjoy spamming Slashdot using Tcl! 172488 93625 21182

    174759 I enjoy spamming Slashdot using Tcl! 220996 103013 92250

    62707 I enjoy spamming Slashdot using Tcl! 87104 22161 182518

    70655 I enjoy spamming Slashdot using Tcl! 61692 211069 150866

    74763 I enjoy spamming Slashdot using Tcl! 12280 191657 158574

    149911 I enjoy spamming Slashdot using Tcl! 56948 177045 21322

    77219 I enjoy spamming Slashdot using Tcl! 227376 190273 116390

    173487 I enjoy spamming Slashdot using Tcl! 54124 38381 112578

    176635 I enjoy spamming Slashdot using Tcl! 173672 141849 188446

    152903 I enjoy spamming Slashdot using Tcl! 125220 186757 73274

    159891 I enjoy spamming Slashdot using Tcl! 35488 31985 109782

    65119 I enjoy spamming Slashdot using Tcl! 126236 72093 139570

    219947 I enjoy spamming Slashdot using Tcl! 144024 122760 177038

    189495 I enjoy spamming Slashdot using Tcl! 111892 94709 72426

    204163 I enjoy spamming Slashdot using Tcl! 70160 123297 30214

    200591 I enjoy spamming Slashdot using Tcl! 206028 153805 116642

    184539 I enjoy spamming Slashdot using Tcl! 205576 148793 156030

    49447 I enjoy spamming Slashdot using Tcl! 160964 217701 15898

    17075 I enjoy spamming Slashdot using Tcl! 192 202129 47606

    67263 I enjoy spamming Slashdot using Tcl! 5500 116477 49554

    223051 I enjoy spamming Slashdot using Tcl! 87608 44265 18862

    58199 I enjoy spamming Slashdot using Tcl! 148596 189973 125450

    226467 I enjoy spamming Slashdot using Tcl! 133744 153281 141798

    180655 I enjoy spamming Slashdot using Tcl! 5612 225069 194626

    12923 I enjoy spamming Slashdot using Tcl! 106920 39577 39134

    117831 I enjoy spamming Slashdot using Tcl! 45988 181445 121722

    77779 I enjoy spamming Slashdot using Tcl! 70496 215793 232150

    220831 I enjoy spamming Slashdot using Tcl! 201308 109725 1522

    208619 I enjoy spamming Slashdot using Tcl! 224856 79753 1550

    2487 I enjoy spamming Slashdot using Tcl! 86164 143861 6378

    117955 I enjoy spamming Slashdot using Tcl! 32912 100449 39046

    232463 I enjoy spamming Slashdot using Tcl! 99404 117261 109858

    72155 I enjoy spamming Slashdot using Tcl! 16392 179449 219326

    200103 I enjoy spamming Slashdot using Tcl! 99460 171557 65754

    200371 I enjoy spamming Slashdot using Tcl! 26048 177105 112822

    113279 I enjoy spamming Slashdot using Tcl! 164796 167293 63890

    126027 I enjoy spamming Slashdot using Tcl! 227704 208361 157998

    157975 I enjoy spamming Slashdot using Tcl! 177332 124629 55306

    68003 I enjoy spamming Slashdot using Tcl! 123120 16897 210854

    17391 I enjoy spamming Slashdot using Tcl! 139948 3245 137922

    55099 I enjoy spamming Slashdot using Tcl! 8936 115353 92830

    91847 I enjoy spamming Slashdot using Tcl! 46884 117061 115898

    29714 I enjoy spamming Slashdot using Tcl! 224992 178289 161046

    47263 I enjoy spamming Slashdot using Tcl! 142940 71517 147634

    107051 I enjoy spamming Slashdot using Tcl! 91608 156745 167822

    85239 I enjoy spamming Slashdot using Tcl! 171796 189173 149610

    56707 I enjoy spamming Slashdot using Tcl! 35024 148641 141958

    35855 I enjoy spamming Slashdot using Tcl! 179532 58189 55586

    106203 I enjoy spamming Slashdot using Tcl! 135880 191417 25854

    5671 I enjoy spamming Slashdot using Tcl! 73988 35685 231322

    217843 I enjoy spamming Slashdot using Tcl! 170240 180177 225334

    93311 I enjoy spamming Slashdot using Tcl! 133308 63804 35282

    215499 I enjoy spamming Slashdot using Tcl! 63735 93353 57390

    89047 I enjoy spamming Slashdot using Tcl! 131444 222741 3658

    13475 I enjoy spamming Slashdot using Tcl! 108912 138049 69926

    46383 I enjoy spamming Slashdot using Tcl! 122859 164717 132354

    55291 I enjoy spamming Slashdot using Tcl! 161768 230745 32542

    158279 I enjoy spamming Slashdot using Tcl! 205476 151813 18170

    153747 I enjoy spamming Slashdot using Tcl! 43744 71921 172758

    38815 I enjoy spamming Slashdot using Tcl! 183452 126429 946

    216683 I enjoy spamming Slashdot using Tcl! 111960 27337 35534

    226551 I enjoy spamming Slashdot using Tcl! 215188 203765 100842

    195139 I enjoy spamming Slashdot using Tcl! 118736 65313 64390

    110927 I enjoy spamming Slashdot using Tcl! 217164 153421 44258

    187035 I enjoy spamming Slashdot using Tcl! 92872 15929 72126

    213223 I enjoy spamming Slashdot using Tcl! 123140 202917 145114

    229811 I enjoy spamming Slashdot using Tcl! 210048 219025 199862

    190719 I enjoy spamming Slashdot using Tcl! 65596 130493 8850

    15307 I enjoy spamming Slashdot using Tcl! 118904 228201 165358

    29015 I enjoy spamming Slashdot using Tcl! 12852 146389 191306

    159843 I enjoy spamming Slashdot using Tcl! 55600 3137 66534

    223471 I enjoy spamming Slashdot using Tcl! 28268 63405 47362

    130618 I enjoy spamming Slashdot using Tcl! 14376 91033 174110

    16647 I enjoy spamming Slashdot using Tcl! 218404 22661 167418

    60115 I enjoy spamming Slashdot using Tcl! 6752 97329 179926

    223583 I enjoy spamming Slashdot using Tcl! 136860 208477 70514

    149931 I enjoy spamming Slashdot using Tcl! 9688 111305 462

    147319 I enjoy spamming Slashdot using Tcl! 209876 18933 18730

    230147 I enjoy spamming Slashdot using Tcl! 69264 187681 36038

    15375 I enjoy spamming Slashdot using Tcl! 51532 191309 187746

    174043 I enjoy spamming Slashdot using Tcl! 93320 217017 185854

    72551 I enjoy spamming Slashdot using Tcl! 200388 184165 226202

    1779 I enjoy spamming Slashdot using Tcl! 32896 184913 184950

    62527 I enjoy spamming Slashdot using Tcl! 45884 147261 136978

    139595 I enjoy spamming Slashdot using Tcl! 219192 120169 96686

    31383 I enjoy spamming Slashdot using Tcl! 109300 14357 147594

    201571 I enjoy spamming Slashdot using Tcl! 223088 198465 27622

    120239 I enjoy spamming Slashdot using Tcl! 47916 151213 36290

    26427 I enjoy spamming Slashdot using Tcl! 202984 68441 231198

    230919 I enjoy spamming Slashdot using Tcl! 202020 200197 40634

    72531 I enjoy spamming Slashdot using Tcl! 14368 16625 13782

    164959 I enjoy spamming Slashdot using Tcl! 50396 122973 49330

    5867 I enjoy spamming Slashdot using Tcl! 30743 231241 164302

    4919 I enjoy spamming Slashdot using Tcl! 78036 128053 175850

    104067 I enjoy spamming Slashdot using Tcl! 97744 74081 200838

    170575 I enjoy spamming Slashdot using Tcl! 30091 232269 161250

    78427 I enjoy spamming Slashdot using Tcl! 32264 138681 116158

    115175 I enjoy spamming Slashdot using Tcl! 70212 140389 139226

    53043 I enjoy spamming Slashdot using Tcl! 15039 201617 184374

    70591 I enjoy spamming Slashdot using Tcl! 166268 94845 170962

    130379 I enjoy spamming Slashdot using Tcl! 114936 180073 191150

    108567 I enjoy spamming Slashdot using Tcl! 195124 212501 172938

    80035 I enjoy spamming Slashdot using Tcl! 58351 171969 165286

    59183 I enjoy spamming Slashdot using Tcl! 202860 81517 78914

    129531 I enjoy spamming Slashdot using Tcl! 159208 214745 49182

    28999 I enjoy spamming Slashdot using Tcl! 97316 59012 21370

    57107 I enjoy spamming Slashdot using Tcl! 22944 240 191318

    38175 I enjoy spamming Slashdot using Tcl! 62812 130589 201906

    73003 I enjoy spamming Slashdot using Tcl! 205400 144777 128014

    46391 I enjoy spamming Slashdot using Tcl! 197268 91765 217322

    223299 I enjoy spamming Slashdot using Tcl! 61456 115553 86790

    134287 I enjoy spamming Slashdot using Tcl! 71564 118221 174178

    182555 I enjoy spamming Slashdot using Tcl! 181512 45049 79166

    140583 I enjoy spamming Slashdot using Tcl! 77380 91877 92634

    135091 I enjoy spamming Slashdot using Tcl! 84608 134865 82102

    154559 I enjoy spamming Slashdot using Tcl! 131196 15613 165650

    178827 I enjoy spamming Slashdot using Tcl! 32824 215081 141678

    230935 I enjoy spamming Slashdot using Tcl! 117556 54293 210570

    175267 I enjoy spamming Slashdot using Tcl! 47024 19521 122278

    116975 I enjoy spamming Slashdot using Tcl! 15852 55789 128066

    63483 I enjoy spamming Slashdot using Tcl! 73000 177497 26334

    37831 I enjoy spamming Slashdot using Tcl! 129187 1605 47482

    80339 I enjoy spamming Slashdot using Tcl! 86496 199153 128150

    144927 I enjoy spamming Slashdot using Tcl! 123483 136541 40818

    150955 I enjoy spamming Slashdot using Tcl! 202712 104649 145486

    190583 I enjoy spamming Slashdot using Tcl! 200340 204277 197354

    191811 I enjoy spamming Slashdot using Tcl! 191248 86945 176262

    203599 I enjoy spamming Slashdot using Tcl! 189836 17613 105250

    136667 I enjoy spamming Slashdot using Tcl! 46344 226681 24638

    126375 I enjoy spamming Slashdot using Tcl! 198532 184229 121626

    118003 I enjoy spamming Slashdot using Tcl! 12800 129296 82294

    74111 I enjoy spamming Slashdot using Tcl! 13308 188605 232082

    54923 I enjoy spamming Slashdot using Tcl! 4920 87337 89774

    128150 I enjoy spamming Slashdot using Tcl! 154228 85205 88842

    90979 I enjoy spamming Slashdot using Tcl! 138416 217473 228070

    113327 I enjoy spamming Slashdot using Tcl! 144684 196141 107138

    200955 I enjoy spamming Slashdot using Tcl! 92392 217049 16926

    14023 I enjoy spamming Slashdot using Tcl! 73700 156357 58234

    7571 I enjoy spamming Slashdot using Tcl! 16608 88945 115862

    161439 I enjoy spamming Slashdot using Tcl! 203356 29213 221490

    32107 I enjoy spamming Slashdot using Tcl! 78104 60681 138958

    126455 I enjoy spamming Slashdot using Tcl! 9492 154549 38186

    165123 I enjoy spamming Slashdot using Tcl! 176080 143777 158214

    67471 I enjoy spamming Slashdot using Tcl! 73868 85965 159202

    158939 I enjoy spamming Slashdot using Tcl! 45576 81913 29630

    134247 I enjoy spamming Slashdot using Tcl! 166084 16421 215898

    42355 I enjoy spamming Slashdot using Tcl! 216512 154449 41206

    27263 I enjoy spamming Slashdot using Tcl! 47100 26557 12434

    224331 I enjoy spamming Slashdot using Tcl! 95608 35945 83502

    112279 I enjoy spamming Slashdot using Tcl! 194996 188373 173770

    120227 I enjoy spamming Slashdot using Tcl! 169584 144001 142118

    124335 I enjoy spamming Slashdot using Tcl! 120172 124589 149826

    199483 I enjoy spamming Slashdot using Tcl! 164840 109977 12574

    126791 I enjoy spamming Slashdot using Tcl! 101988 123205 107642

    223059 I enjoy spamming Slashdot using Tcl! 162016 204593 103830

    226207 I enjoy spamming Slashdot using Tcl! 48284 74781 179698

    202475 I enjoy spamming Slashdot using Tcl! 233112 70473 1870

    179447 I enjoy spamming Slashdot using Tcl! 200724 43381 194858

    71235 I enjoy spamming Slashdot using Tcl! 90832 170849 12486

    8142 I enjoy spamming Slashdot using Tcl! 204620 121677 125794

    160091 I enjoy spamming Slashdot using Tcl! 29448 74425 134462

    66279 I enjoy spamming Slashdot using Tcl! 184516 224933 96090

    86707 I enjoy spamming Slashdot using Tcl! 62144 216081 111478

    209855 I enjoy spamming Slashdot using Tcl! 56892 122748 65426

    182283 I enjoy spamming Slashdot using Tcl! 217720 192617 222894

    27031 I enjoy spamming Slashdot using Tcl! 222068 42645 114442

    17699 I enjoy spamming Slashdot using Tcl! 205296 110593 143270

    108207 I enjoy spamming Slashdot using Tcl! 112684 229421 81858

    217915 I enjoy spamming Slashdot using Tcl! 140072 223449 56926

    205703 I enjoy spamming Slashdot using Tcl! 163620 193477 56954

    232851 I enjoy spamming Slashdot using Tcl! 208992 194929 31766

    172383 I enjoy spamming Slashdot using Tcl! 50140 74717 50994

    86251 I enjoy spamming Slashdot using Tcl! 19928 175305 167182

    197879 I enjoy spamming Slashdot using Tcl! 175956 156853 5930

    150147 I enjoy spamming Slashdot using Tcl! 152464 7840 195078

    17935 I enjoy spamming Slashdot using Tcl! 67532 174669 83746

    48923 I enjoy spamming Slashdot using Tcl! 186120 213817 49214

    93351 I enjoy spamming Slashdot using Tcl! 38788 165605 226842

    122419 I enjoy spamming Slashdot using Tcl! 28736 217233 95350

    202367 I enjoy spamming Slashdot using Tcl! 161724 54781 83858

    157515 I enjoy spamming Slashdot using Tcl! 97912 3689 68526

    88663 I enjoy spamming Slashdot using Tcl! 59059 225237 124234

    113891 I enjoy spamming Slashdot using Tcl! 25008 68545 32102

    31599 I enjoy spamming Slashdot using Tcl! 18796 144173 108930

    72187 I enjoy spamming Slashdot using Tcl! 80744 120921 92638

    172295 I enjoy spamming Slashdot using Tcl! 164772 177349 49466

    104403 I enjoy spamming Slashdot using Tcl! 190240 42737 37014

    228511 I enjoy spamming Slashdot using Tcl! 16028 59805 156082

    66539 I enjoy spamming Slashdot using Tcl! 36696 70153 58190

    64887 I enjoy spamming Slashdot using Tcl! 67924 88181 8298

    13315 I enjoy spamming Slashdot using Tcl! 20432 197409 3526

    185423 I enjoy spamming Slashdot using Tcl! 29580 135757 213794

    68571 I enjoy spamming Slashdot using Tcl! 40648 202745 178302

    48679 I enjoy spamming Slashdot using Tcl! 16196 222693 23770

    217907 I enjoy spamming Slashdot using Tcl! 65664 63121 205238

    37695 I enjoy spamming Slashdot using Tcl! 30652 75389 2706

    23563 I enjoy spamming Slashdot using Tcl! 158840 57897 139054

    86231 I enjoy spamming Slashdot using Tcl! 67188 7765 188042

    127778 I enjoy spamming Slashdot using Tcl! 193456 94913 103590

    93487 I enjoy spamming Slashdot using Tcl! 137324 91821 38338

    179195 I enjoy spamming Slashdot using Tcl! 189672 125209 84446

    27783 I enjoy spamming Slashdot using Tcl! 218020 183557 169914

    180691 I enjoy spamming Slashdot using Tcl! 107168 13425 110422

    185759 I enjoy spamming Slashdot using Tcl! 122076 104413 49970

    126507 I enjoy spamming Slashdot using Tcl! 26584 30281 123918

    207415 I enjoy spamming Slashdot using Tcl! 223892 211509 44266

    28163 I enjoy spamming Slashdot using Tcl! 19920 100897 6854

    112911 I enjoy spamming Slashdot using Tcl! 7948 23885 121121

    95899 I enjoy spamming Slashdot using Tcl! 176456 141753 228670

    95207 I enjoy spamming Slashdot using Tcl! 38724 36901 110618

    142515 I enjoy spamming Slashdot using Tcl! 84352 86609 83766

    1663 I enjoy spamming Slashdot using Tcl! 120379 192957 119314

    75851 I enjoy spamming Slashdot using Tcl! 100728 67945 50222

    137559 I enjoy spamming Slashdot using Tcl! 178036 140693 167370

    80227 I enjoy spamming Slashdot using Tcl! 211184 54081 104998

    125615 I enjoy spamming Slashdot using Tcl! 128172 116269 214466

    20283 I enjoy spamming Slashdot using Tcl! 211240 108377 60894

    20551 I enjoy spamming Slashdot using Tcl! 137828 113925 107962

    166739 I enjoy spamming Slashdot using Tcl! 43296 104113 59029

    179487 I enjoy spamming Slashdot using Tcl! 106204 145181 153138

    211435 I enjoy spamming Slashdot using Tcl! 55832 61449 50446

    121462 I enjoy spamming Slashdot using Tcl! 1620 186997 205994

    70851 I enjoy spamming Slashdot using Tcl! 18448 173345 133062

    108559 I enjoy spamming Slashdot using Tcl! 120715 52173 87970

    145307 I enjoy spamming Slashdot using Tcl! 158664 53881 111038

    83175 I enjoy spamming Slashdot using Tcl! 103492 115109 156186

    100723 I enjoy spamming Slashdot using Tcl! 21440 8337 142774

    160511 I enjoy spamming Slashdot using Tcl! 203388 93565 162962

    138699 I enjoy spamming Slashdot using Tcl! 50296 125992 144750

    110167 I enjoy spamming Slashdot using Tcl! 146804 85461 137098

    89315 I enjoy spamming Slashdot using Tcl! 58032 228289 50726

    159663 I enjoy spamming Slashdot using Tcl! 14380 128237 20994

    59131 I enjoy spamming Slashdot using Tcl! 185768 205785 226462

    87239 I enjoy spamming Slashdot using Tcl! 111396 147013 163130

    68307 I enjoy spamming Slashdot using Tcl! 151264 44081 173718

    103135 I enjoy spamming Slashdot using Tcl! 60571 58269 99826

    76523 I enjoy spamming Slashdot using Tcl! 52440 5257 189134

    20151 I enjoy spamming Slashdot using Tcl! 149908 29045 58601

    164419 I enjoy spamming Slashdot using Tcl! 160016 31713 145990

    212687 I enjoy spamming Slashdot using Tcl! 36684 191821 50978

    170715 I enjoy spamming Slashdot using Tcl! 165832 5369 64446

    165223 I enjoy spamming Slashdot using Tcl! 173060 48357 53914

    184691 I enjoy spamming Slashdot using Tcl! 219648 162385 137462

    208959 I enjoy spamming Slashdot using Tcl! 121276 128573 113490

    27787 I enjoy spamming Slashdot using Tcl! 21944 30441 212398

    148055 I enjoy spamming Slashdot using Tcl! 57012 72469 137546

    57123 I enjoy spamming Slashdot using Tcl! 171760 87617 127974

    140911 I enjoy spamming Slashdot using Tcl! 95468 133485 77122

    25019 I enjoy spamming Slashdot using Tcl! 170856 77593 206750

    104007 I enjoy spamming Slashdot using Tcl! 6244 38021 30137

    193555 I enjoy spamming Slashdot using Tcl! 82592 46449 36886

    204383 I enjoy spamming Slashdot using Tcl! 16860 99997 34034

    38571 I enjoy spamming Slashdot using Tcl! 13528 135305 208782

    107959 I enjoy spamming Slashdot using Tcl! 138836 158133 13930

    141827 I enjoy spamming Slashdot using Tcl! 217104 61921 8198

    16335 I enjoy spamming Slashdot using Tcl! 115852 68429 119586

    39643 I enjoy spamming Slashdot using Tcl! 186440 157497 163774

    226151 I enjoy spamming Slashdot using Tcl! 227268 118885 51482

    192819 I enjoy spamming Slashdot using Tcl! 2176 226193 151350

    144127 I enjoy spamming Slashdot using Tcl! 147644 200061 175378

    146315 I enjoy spamming Slashdot using Tcl! 202872 193129 86126

    23703 I enjoy spamming Slashdot using Tcl! 61300 64277 226314

    110371 I enjoy spamming Slashdot using Tcl! 177968 208065 204262

    57839 I enjoy spamming Slashdot using Tcl! 66156 206893 34370

    131067 I enjoy spamming Slashdot using Tcl! 215464 204761 33438

    93895 I enjoy spamming Slashdot using Tcl! 199652 103749 172666

    116243 I enjoy spamming Slashdot using Tcl! 205920 82417 51734

    203871 I enjoy spamming Slashdot using Tcl! 153628 103325 194802

    16939 I enjoy spamming Slashdot using Tcl! 134936 42633 2830

    10487 I enjoy spamming Slashdot using Tcl! 77844 208501 60458

    164355 I enjoy spamming Slashdot using Tcl! 31312 148769 166086

    35023 I enjoy spamming Slashdot using Tcl! 139340 180237 83554

    129371 I enjoy spamming Slashdot using Tcl! 70728 40825 216062

    168039 I enjoy spamming Slashdot using Tcl! 4035 30053 102810

    70387 I enjoy spamming Slashdot using Tcl! 135104 205521 103798

    161855 I enjoy spamming Slashdot using Tcl! 106812 201469 207506

    137163 I enjoy spamming Slashdot using Tcl! 227320 135977 160494

    45271 I enjoy spamming Slashdot using Tcl! 44468 40725 219082

    30178 I enjoy spamming Slashdot using Tcl! 108336 146113 190310

    227247 I enjoy spamming Slashdot using Tcl! 156844 155501 28098

    115195 I enjoy spamming Slashdot using Tcl! 22952 74649 118366

    123142 I enjoy spamming Slashdot using Tcl! 230820 30276 86714

    127251 I enjoy spamming Slashdot using Tcl! 181408 10865 94422

    202399 I enjoy spamming Slashdot using Tcl! 226076 229533 190450

    129707 I enjoy spamming Slashdot using Tcl! 163224 9481 52238

    225975 I enjoy spamming Slashdot using Tcl! 223252 90869 48426

    229123 I enjoy spamming Slashdot using Tcl! 109520 194337 124294

    205391 I enjoy spamming Slashdot using Tcl! 61068 5965 9122

    212379 I enjoy spamming Slashdot using Tcl! 204616 84473 45630

    117607 I enjoy spamming Slashdot using Tcl! 62083 124580 75418

    39155 I enjoy spamming Slashdot using Tcl! 79872 175249 112886

    8703 I enjoy spamming Slashdot using Tcl! 47740 147197 8274

    23371 I enjoy spamming Slashdot using Tcl! 6008 175785 199342

    19799 I enjoy spamming Slashdot using Tcl! 141876 206293 52490

    3746 I enjoy spamming Slashdot using Tcl! 141424 201281 91878

    101935 I enjoy spamming Slashdot using Tcl! 96812 36909 185026

    69563 I enjoy spamming Slashdot using Tcl! 169320 21337 216734

    119751 I enjoy spamming Slashdot using Tcl! 174628 168965 218682

    42259 I enjoy spamming Slashdot using Tcl! 23456 96753 187990

    110687 I enjoy spamming Slashdot using Tcl! 84444 9181 61298

    45675 I enjoy spamming Slashdot using Tcl! 69592 205769 77646

    233143 I enjoy spamming Slashdot using Tcl! 125523 214901 100458

    122755 I enjoy spamming Slashdot using Tcl! 121232 185889 164806

    27023 I enjoy spamming Slashdot using Tcl! 147660 115597 29474

    82971 I enjoy spamming Slashdot using Tcl! 72328 225785 89022

    132199 I enjoy spamming Slashdot using Tcl! 13316 29733 159130

    189107 I enjoy spamming Slashdot using Tcl! 2304 17041 150518

    103935 I enjoy spamming Slashdot using Tcl! 36412 228029 198546

    81163 I enjoy spamming Slashdot using Tcl! 52280 150057 15213

    187031 I enjoy spamming Slashdot using Tcl! 55668 169045 29642

    12579 I enjoy spamming Slashdot using Tcl! 173296 143873 117990

    125167 I enjoy spamming Slashdot using Tcl! 160364 2541 121858

    176315 I enjoy spamming Slashdot using Tcl! 229992 27289 55646

    197703 I enjoy spamming Slashdot using Tcl! 171940 128837 2874

    186451 I enjoy spamming Slashdot using Tcl! 26528 209265 168022

    79199 I enjoy spamming Slashdot using Tcl! 214236 213853 150770

    114987 I enjoy spamming Slashdot using Tcl! 187864 105161 8718

    187255 I enjoy spamming Slashdot using Tcl! 39572 225909 75946

    51203 I enjoy spamming Slashdot using Tcl! 163920 184417 3974

    153231 I enjoy spamming Slashdot using Tcl! 143308 228365 57762

    49819 I enjoy spamming Slashdot using Tcl! 121735 207993 1150

    14567 I enjoy spamming Slashdot using Tcl! 1284 94501 4058

    1395 I enjoy spamming Slashdot using Tcl! 193792 187409 72246

    162943 I enjoy spamming Slashdot using Tcl! 195260 77757 99154

    1. Re:He he he... by Anonymous Coward · · Score: 0

      Tcl? Wimp. Real programmers use cat > myprog; chmod 755 myprog

  35. Return to the Dark Ages by Anonymous Coward · · Score: 0
    Censorship is on the rise. Is it coming to America?

    Dozens of other Americans, Europeans, Australians and Canadians have been jailed for exercising their right to free speech.

    Read more about it here

    Vanguard News Network

  36. Funny fable, old concept by Uttles · · Score: 1

    This fable really is just an illustration of the age-old witch hunt. I don't agree with the DMCA but I don't think it would be enforced in such a way. While we're talking about witch hunts, we have something much worse than what's described in this article around already: rape. Look at how those cases are investigated, it's terrible. Anyway, nice story

    --

    ~ now you know
    1. Re:Funny fable, old concept by Anonymous Coward · · Score: 0

      didn't you check the link at the end?

  37. Oops, sorry that link is incorrect. Sorry :-) by Anonymous Coward · · Score: -1, Offtopic

    * g o a t s e x * g o a t s e x * g o a t s e x *
    g g
    o / \ \ / \ o
    a| | \ | | a
    t| `. | | : t
    s` | | \| | s
    e \ | / / \\\ -- \\ : e
    x \ \/ --~~ ~--| \ | x
    * \ \-~ ~-\ | *
    g \ \ .--------.__\| | g
    o \ \_// ((> \ | o
    a \ . C ) _ ((> | / a
    t /\ | C )/ \ (> |/ t
    s / /\| C) | (> / \ s
    e | ( C__)\__/ // / / \ e
    x | \ | \\__// (/ | x
    * | \ \) `---- --' | *
    g | \ \ / / | g
    o | / | | \ | o
    a | | / \ \ | a
    t | / / | | \ |t
    s | / / \/\/ | |s
    e | / / | | | |e
    x | | | | | |x
    * g o a t s e x * g o a t s e x * g o a t s e x *

  38. Bullies by Maskirovka · · Score: 2, Funny
    "The only way to beat bullies is to stand up to them."

    I like this Tom Clany quote better:

    There are two ways you can deal with bullies
    You can shock them; or
    you can kill them.

    Needless to say there are at least 50000 bullies (ie, industry lobiests) in washington alone, so killing is out. Any great ideas on how to collectively shock them? The sheer logistics are mind bogling, but it would be fun to try 8)

    Maskirovka

    I don't care that my spelling stinks.

    1. Re:Bullies by Nick+Number · · Score: 1

      Needless to say there are at least 50000 bullies (ie, industry lobiests) in washington alone, so killing is out. Any great ideas on how to collectively shock them? The sheer logistics are mind bogling, but it would be fun to try 8)

      Get them to hotsync their Palm Pilots all at once.

      --
      Promote proofreading. Don't mod up sloppy posts.
    2. Re:Bullies by tbone1 · · Score: 2, Funny
      Needless to say there are at least 50000 bullies (ie, industry lobiests) in washington alone, so killing is out.

      Well, if we keep them in DC, they'll probably get shot anyway.

      --

      The Independent: Reverend Spooner Arrested in Friar Tuck Incident - ISIHAC, Historical Headlines
    3. Re:Bullies by Dimensio · · Score: 1

      Needless to say there are at least 50000 bullies (ie, industry lobiests) in washington alone, so killing is out.

      Actually, if you could find a way to kill, say, just 100 of them and make it clear to everyone why they were killed then the remaining lobbyists might be shocked sufficiently.

    4. Re:Bullies by kenthorvath · · Score: 2

      Okay, so you get a REALLY REALLY big capacitor bank and then... um never mind.

    5. Re:Bullies by Anonymous Coward · · Score: 0

      Mod this guy up +1 Funny
      Mod this guy up for his sig!

    6. Re:Bullies by mimbleton · · Score: 1

      You racist pig !

      PS.

      Seriously, if you were to mention that in politically correct environment, you would be severely punished for complete lack of sensitivity etc ..

    7. Re:Bullies by Anonymous Coward · · Score: 0

      there is nothing racist about the fact that DC has one of the highest murder rates in the US, some years, they are #1.

    8. Re:Bullies by Mija+Cat · · Score: 1

      Technically, this is incorrect.

      Had he said that they'd be shot by a person of specific ethnicity, then he'd be racist.

      As to D.C.'s insanely high crime rate, it's more a function of economics than race, so it would be more accurate to call him an economist...

      Meow.

      --
      Yes, that's really my e-mail. Don't change a thing.
  39. FLOPPY DICK NEEDS WORK - CALL XXX-XXXX by Anonymous Coward · · Score: -1, Offtopic

    Can I reformat my dick in my floppy drive? I'd like to try.

  40. WARNING: GOAT SEX LINK! by Anonymous Coward · · Score: -1, Troll
    Specifically, the link that points to this comment is a link to the goat sex ascii.


    * g o a t s e x * g o a t s e x * g o a t s e x *
    g g
    o / \ \ / \ o
    a| | \ | | a
    t| `. | | : t
    s` | | \| | s
    e \ | / / \\\ -- \\ : e
    x \ \/ --~~ ~--| \ | x
    * \ \-~ ~-\ | *
    g \ \ .--------.__\| | g
    o \ \_// ((> \ | o
    a \ . C ) _ ((> | / a
    t /\ | C )/ \ (> |/ t
    s / /\| C) | (> / \ s
    e | ( C__)\__/ // / / \ e
    x | \ | \\__// (/ | x
    * | \ \) `---- --' | *
    g | \ \ / / | g
    o | / | | \ | o
    a | | / \ \ | a
    t | / / | | \ |t
    s | / / \/\/ | |s
    e | / / | | | |e
    x | | | | | |x
    * g o a t s e x * g o a t s e x * g o a t s e x *

  41. circumvention by Anonymous Coward · · Score: 0

    Skylarov isn't guilty of anything. The DMCA itself is a circumvention device as it prevents us from creating our legally allowed backups of data for items we purchase. Skylarov, if anything, simply provided us a way to over-ride the (should be) illegal circumvention device that is the DMCA.

  42. ATTENTION MODERATORS by Anonymous Coward · · Score: -1, Offtopic

    Kiss The Blade, also known as KTB, Lover's Arrival, The, and many other gay names, is a KNOWN TROLL and should be modded down as such. He should NOT be MODDED UP, he should be MODDED DOWN. He is trolling you, don't you see? He is also a member of the ultra-gay Wiccan THC (Troll High Council) and should have his IP banned immediately. Thank you for your time.

    1. Re:ATTENTION MODERATORS by Anomymous+Coward · · Score: -1

      heh, even the meta-trolls get modded up these days ... sad, very very sad.

  43. The "law" is not always important by fcd · · Score: 5, Insightful
    An unjust law does not demand being followed simply because it is the law. Our country has a history of unjust laws. Take for example the Jim Crow laws in the south. You state that you agree with the people who put MLK in jail. The people who turned dogs and hoses on protestors, civil protestors, not violent ones, simply because it is the law?


    It is our duty as Americans to protest and commit acts of civil disobiedience when we believe a law is unjust. We must, of course, expect to be punished for our actions, but we must never fall blindly into the belief that we should obey and accept people punsihed under unjust laws, to do so is to sign away our freedoms one by one, because as many of you know waiting and writing to Congress to get something done, is not the most effective thing you can do.


    Someone who is being punished under an unjust law is being unjustly punished, and you should not support punishing him, if you do not believe the law is just, to do so is hipocrasy.

    1. Re:The "law" is not always important by StrawberryFrog · · Score: 1
      It is our duty as Americans to protest and commit acts of civil disobiedience when we believe a law is unjust.

      You make it sound like it was just an American thing :) It is our right as free human beings to do this. As a South African, I can think of other instances of unjust laws and resistance to them.

      --

      My Karma: ran over your Dogma
      StrawberryFrog

    2. Re:The "law" is not always important by meatplow · · Score: 1


      It is our duty as Americans to protest and commit acts of civil disobiedience when we believe a law is unjust. We must, of course, expect to be punished for our actions, but we must never fall blindly into the belief that we should obey and accept people punsihed under unjust laws, to do so is to sign away our freedoms one by one, because as many of you know waiting and writing to Congress to get something done, is not the most effective thing you can do.

      You couldn't be more correct.

      remember the following... (qw may be off a bit)

      I disagree with what you say, but will fight to the death for your ability to say it.

      remember

      "He who would sacrifice a little bit of liberty
      for a little bit of safety deserves neither." - Benjamin Franklin.

    3. Re:The "law" is not always important by error0x100 · · Score: 1

      This is not exactly on-topic, but relates to what you're saying .. in psychology, development of moral reasoning, we learnt that there are basically six stages of moral reasoning that people go through as they grow up. The majority of people stop developing at about age 16 at stage 4 ("conventional morality"), which is "preserve the social order" - this stage basically amounts to "rules are rules, we must follow them". And so we see such posts on slashdot :)

      A few people (usually people who study further after school) progress to stages 5 and 6 ("post-conventional morality"), which involve actually thinking about the rights of individuals, and "an orientation toward universal principles of justice".

      Its interesting to see this sort of discussion on topics like the Sklyarov case in terms of that, as you can usually categorize which stage someone is in by their posts :) (The earlier stages are typically reasoning that children use, e.g. "don't get caught").

    4. Re:The "law" is not always important by Anonymous Coward · · Score: 0

      Thomas Jefferson: "If a law is unjust, a man is not only right to disobey it, he is obligated to do so."

  44. All this ascii art is making me want to by Anonymous Coward · · Score: -1, Troll


    +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+
    * \ \ \ *
    j / \ \ j
    a \ \ a
    c \ \ c
    k / \ \ \/,,..---v--. k
    o ,,\.--"""\/ \ o
    f \ > f
    f / f
    * /vvv\..---""'`-' *
    j ,,. j
    a / \ \hhh/ a
    c c
    k k
    o \ \ o
    f \ \/ f
    f \ f
    * \ *
    j j
    a a
    c c
    k k
    o o
    f f
    f f
    * *
    +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+

    aoisfhoasfhiuasfiugsafihudfsahuifsoihhuasdghgdsh lk hklsdghjgdashjImportant Stuff:
    Please try to keep posts on topic.
    Try to reply to other people comments instead of starting new threads.
    Read other peoplmessages before posting your own to avoid simply duplicating what has already been said.
    Use a clear subject that describes what your message is about.
    Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page)
    Problems regarding accounts or comment posting should be
    e's messages before posting your own to avoid simply duplicating what has already been said.
    Your comment violated CmdrTaco's anus. Comment aborted

  45. Biased Slashdot Coverage.. by Bowie+J.+Poag · · Score: -1, Troll



    I know this will probably earn me a -1 Flamebait moderation, but i've been thinking about something lately, regarding Slashdot.

    What strikes me as particularly odd, is the fact that Slashdot chooses to embrace the cause of Mr. Sklyarov, despite the fact that he knowingly and willfully comitted an act of copyright infringement. This is a crime. While its not on par with grand theft or murder, it is a crime nonetheless. Not only did he commit a crime, but he also didn't find much harm in holding a lecture to inform and encourage others how to do the same. No matter how small a dent in some company's bottom line it made, it's still illegal..You can call it whatever you want, and make up elaborate dances to justify it, but its still a crime, enforced by law.. Laws that you and I have citizens helped create to protect the rights of our property.

    Now, suppose the company being victimized was VA Linux Systems, OSDN, BSI, or perhaps more poigniantly, Slashdot. Slashdot holds numerous copyrights, each of which i'm sure they'de defend rigorously in court. If someone came along and decided to "pull a Dmitry" on Rob and Jeff, they would likely throw a fit, and let loose the dogs of war on whoever did it. They wouldn't embrace the offender as some sort of Robin Hood'ish cult hero.

    Thats a double-standard i'm not quite comfortable with. Many would argue that the sheer numbers of readers here at Slashdot almost demand unbiased reporting, but, its their page, they can do what they want...And thats fine....But Slashdot's maintainers should realize that they're seting a dangerous precedent when you hold up one ethical ideal but practice quite another.

    In other words, if you really want to see something funny, try violating one or more of Slashdot's copyrights. I'll bet you dollars to donuts Slashdot wont take up your cause, and run almost daily series of reports on how to defend and support you.

    Cheers,

    --
    Bowie J. Poag

    1. Re:Biased Slashdot Coverage.. by Anonymous Coward · · Score: 0

      That depends on how you define crime pal. You define crime as something illegal (like doing 56 in a 55). I define it as something wrong (like companies using pirated software). Think on that.

    2. Re:Biased Slashdot Coverage.. by furiousgeorge · · Score: 3, Informative

      >>despite the fact that he knowingly and >>willfully comitted an act of copyright
      >>infringement.

      Don't be obtuse.

      First - the 'crime' occured in another country.

      Second - he didn't commit copyright infringement. He developed a tool. If i go down to the library, take a book and photocopy it, does that mean Xerox (and it's engineers) are guilty of 'copyright' infringement. No it doesn't. For the same reason a gun manufacturer isn't guilty of murder if i shoot somebody in the head. For the same reason if i take a hammer and break into your house, Sears isn't guilty of break and enter. If i burn a copy of a friends CD, HP (the manufacturer of my burner) isn't guilty of copyright infringent.

      Don't confuse a tool and the use of a tool. Why should this case be treated differently because it deals with bits instead of physical objects. It's EXACTLY the same as the Xerox example.

      And i won't even go into the agument about how the DMCA tramples other established rights.

    3. Re:Biased Slashdot Coverage.. by daoine · · Score: 4, Insightful
      despite the fact that he knowingly and willfully comitted an act of copyright infringement. This is a crime.

      Not necessarily the case. If it is the case that

      -in Russia, it is legal to copy software and its content for backup purposes
      -in Russia, it is legal to sell software to create said backups
      -Elcomsoft made no sales of circumventing software to US companies

      then in fact, it's pretty hard to enforce a US law, because it doesn't take place in the US. If this had happened to a US programmer in a US company, the case would be much cleaner...because it WOULD be illegal. In fact, it's surprising that they aren't choosing a local to hold up as an example. It would be much easier to convict an American who broke the law in the US.

      Granted, Slashdot creates cult heros, but I think this is the wrong example to pick on them for. In this case, it's not a matter of someone not getting their free-as-in-beer stuff. It's a much more complicated scheme of making an example of someone who didn't necessarily break the law.

    4. Re:Biased Slashdot Coverage.. by Anonymous Coward · · Score: 0

      "If i go down to the library, take a book and photocopy it, does that mean Xerox (and it's engineers) are guilty of 'copyright' infringement. No it doesn't. "

      If you take a CD, compress a song into mp3 form, and send it to someone through napster...

      see where I'm going with this?

    5. Re:Biased Slashdot Coverage.. by radish · · Score: 2, Insightful


      Surely this is a troll?? Well just in case, here's the "Skylarov for Dummies" explanation:

      The guy has NOT been charged with infringing copyright (or if he has that's not what's being complained about) - it's the charge of "creating a circumvention device". This is prosecuting him for creating a tool which MIGHT be used to infringe copyright, but has other legitimate uses as well. If someone uses a hammer to break into my home, I say prosecute the guy breaking in, not the guy who designed the hammer. I bet you use copiers from time to time - what if Xerox were forced to stop making copiers because someone MIGHT use them to copy the pages of a copyright protected book?

      Madness.

      --

      ---- Den ene knappen er powerknapp, den andre er Bender voice knapp "Bite My Shiny Metal Ass"

    6. Re:Biased Slashdot Coverage.. by srvivn21 · · Score: 2

      Why should this case be treated differently because it deals with bits instead of physical objects. It's EXACTLY the same as the Xerox example.

      For the exact same reason that the actual copying and distribution of digital material should be treated differently than that of physical material. They are very distinct beasts. It's not exactly the same as the Xerox example. With a Xerox, I can't make a perfectly bound soft cover (much less a hard cover) book. With e-books, copying the material is both trivial, and EXACT.

      Don't get me wrong. I am all against the current practices of hassling the makers of software that enable the unauthorized copying of proprietary information (commonly known as "pirating"). If it's main purpose is "pirating", it's bad. If it allows "pirating" as a side effect, then those who use it to pirate are bad.

      I just don't feel comfortable with people claiming that digital music should be "sold" with a different business model (because it is different than physical media) while stating that digital tools are the same as physical tools.
    7. Re:Biased Slashdot Coverage.. by Anonymous Coward · · Score: 0

      You ought to read the report then you wouldn't have to speculate anymore
      http://www.usdoj.gov/usao/can/press/assets/applets /2001_08_28_sklyarov_ind.pdf you see exactly what he was arrested for

      - in America it is illegal to sell circumvention software due to the DMCA
      - Elcomsoft sold the circumvention software from a computer located *in the US* (extremely stupid thing to do)
      - Adobe purchased the circumvention software from the website that was on the system *in the US*
      - Skylarov is listed as the *copyright* holder in the opening splash screen
      - Adobe see's splash screen contacts government and says Skylarov's in the US, he's been violating the DMCA, here's your proof, now do your sworn duty

      If Elcomsoft would have kept their server out of the US, nothing would have happened since it *would* have been outside of the US. I personally think this is the fault of Adobe more than anyone else, since they called up and forced the government's hand.

    8. Re:Biased Slashdot Coverage.. by fluch · · Score: 1

      > First - the 'crime' occured in another country.

      DMCA is a USA law and can't be broken in Russia. And _if_ in Russia ther would exist a similar law he could only be charged in Russia, not in the USA...

    9. Re:Biased Slashdot Coverage.. by crankbear · · Score: 1
      Why should this case be treated differently because it deals with bits instead of physical objects. It's EXACTLY the same as the Xerox example.

      I disagree here, as well, though for a different reason: The case of the Xerox machine, the hammer, and all other tools mentioned here are all things that have an intended use. Straying outside the bounds of intended use may result in straying outside the law. I don't see an intended use that falls within the law for copying e-books.

      With e-books, copying the material is both trivial, and EXACT.

      And I disagree here. An mp3 encoded at a bitrate of say 56 is far from an exact copy, but if distributed, is still a clear infringement of copyright. The Xerox example of copying an entire book does mirror copying e-books, as it's still word-for-word the intellectual property of the author (or whomever owns the rights). Xerox, though, for reasons stated above, can hardly be held accountable.

    10. Re:Biased Slashdot Coverage.. by Daffy+Duck · · Score: 2
      Are the words contained in the duplicate not EXACTLY the same as the words in the original? Or do Xerox machines scramble some percentage of the letters they see?

      I'm pretty sure the target of copyright protection is the words, not the perfectly bound soft cover.

    11. Re:Biased Slashdot Coverage.. by Anonymous Coward · · Score: 0
      First - the 'crime' occured in another country.

      The 'crime' was the importing & marketing in the US of an illegal (under the DMCA) tool. If you use a remote-controlled (controlled from, say, Colombia) airplane to try to smuggle a bunch of coke into the US, and my next trip to Miami (with nothing on you) you can expect the feds would want to talk to you. But I digress; read the indictment; everything from the client to the server was in the US.

      Second - he didn't commit copyright infringement. He developed a tool. If i go down to the library, take a book and photocopy it, does that mean Xerox (and it's engineers) are guilty of 'copyright' infringement. No it doesn't. For the same reason a gun manufacturer isn't guilty of murder if i shoot somebody in the head. For the same reason if i take a hammer and break into your house, Sears isn't guilty of break and enter. If i burn a copy of a friends CD, HP (the manufacturer of my burner) isn't guilty of copyright infringent.

      Don't confuse a tool and the use of a tool. Why should this case be treated differently because it deals with bits instead of physical objects. It's EXACTLY the same as the Xerox example.

      It's NOT the same - the distribution of software that effectively controlls copyright access is illegal under US law. The others aren't.

      General note to anyone reading:
      If your understanding of the charges is that some guy was arrested for a program he made while in Russia to help blind people, for the love of god; read the indictment before you post. We're not under any obligation to support every single geek or always support anything anti-DMCA.

    12. Re:Biased Slashdot Coverage.. by Cock+Knocker · · Score: 0
      First - the 'crime' occured in another country.

      All 5 counts in the indictment, which I trust you read, are all trafficing charges. Should I be able to traffic a brick of hash from Amsterdam just because its legal there? kaPOW!

    13. Re:Biased Slashdot Coverage.. by Moridineas · · Score: 1

      The crime occurred in the US, as software sold within the US...ergo...US crime

      Second, made a tool specifically designed to circumvent copyright. The specific goal of a gun is not to kill people. The specific goal of a copy machine is not to break copyright. His product can ONLY be used to break copyright.

      Unless of course, you could give some examples of adobe ebooks that exist free of any copyright and and totally free, that you could use Sklyarov's software on.

    14. Re:Biased Slashdot Coverage.. by donutello · · Score: 2

      A photocopier can be used for several legitimate purposes that are not illegal. Ditto with a gun or hammer.

      (I might be wrong here - and correct me if I am - because I haven't really bothered reading much about the case)

      He sold a program to specifically break the copy-protection mechanism on ebooks. The fact that he wrote the program in another country is not relevant because he (or his company) sold the program in the US.

      --
      Mmmm.. Donuts
    15. Re:Biased Slashdot Coverage.. by dasunt · · Score: 2


      Ironic thought.


      Xerox copies are imperfect, and making copies of copies will result in a degraded copy. The way to do it is to convert it to a digital form, then make copies. An Adobe PDF file is very capable of this.

    16. Re:Biased Slashdot Coverage.. by Garc · · Score: 1
      First - the 'crime' occured in another country.

      Flase, the crime, which was Distribution of a device that allows the circumvention of copyright protection technology, was committed in the USA by an agent of elmsoft. The company (don't remember their name) was located on the west coast and collect funds and sold the software in USA for Elmsoft.

      IANAL, so this is all IMHO

      garc

    17. Re:Biased Slashdot Coverage.. by Anonymous Coward · · Score: 0

      Exactly. If pirated copies of the closed source sourceforge extensions got out on the net i bet they wouldn't be defending the pirates.

    18. Re:Biased Slashdot Coverage.. by Karellen · · Score: 2

      Yes, and a program that breaks the copy protection on an e-book can be used for several legitimate purposes that are not illegal also.

      This includes, but is not limited to, making personal, fair-use copies for purposes of backup or space-shifting.
      Another is to simply prove that such a program can be written, and that the copy protection is not perfect.

      --
      Why doesn't the gene pool have a life guard?
  46. DMCA coming to Europe by Anonymous Coward · · Score: 5, Informative

    It may (and should) outrage all Europeans, but within a year, Dmitry's actions are going to be made illegal in Europe too. Yes, that's right - they've put together a DMCA in Europe called the European Union Copyright Directive. It bans circumventing encryption in the same way. In a year's time, all governments in Europe are obliged to enact it as law.

    We can still stop this! Check out here and if you're in Britain, write a letter to your MP. You can and should make a difference.

  47. For the record . . . by SanLouBlues · · Score: 0, Offtopic

    Is it Dmitri or Dmitry? I see it one way in the elcomsoft statement, and the other in the nytimes.

    1. Re:For the record . . . by Purple_Walrus · · Score: 1

      Either Dmitri, Dmitry or Dmitriy is the correct way to spell it. While this name is spelled only one way in Russian, there are many ways to spell it in English... Probably the closest pronounciation would be "Dmitriy."

      --
      ------
      Sig
    2. Re:For the record . . . by nolesrule · · Score: 1

      Either spelling would be correct. It's not like his original language uses the English alphabet.

      --
      -- nolesrule
    3. Re:For the record . . . by Anonymous Coward · · Score: 0

      OH MY GOD.

      1. Russians use the Cyrillic alphabet. English-speaking people use the Roman alphabet. IT DOES NOT MATTER HOW YOU SPELL IT. HE DOES NOT SPELL HIS NAME WITH OUR ALPHABET. HE SPELLS HIS NAME WITH A BUNCH OF LINES AND SQUIGGLES INDECIPHERABLE TO MOST OF US. "Dmitri" or "Dmitry" are spellings invented by English-speaking people looking for a way to transliterate a non-English name.

      2. If you were used to seeing Dmitri Sklyarov, and you suddenly saw it as Dmitry Sklyarov, would you suddenly become confused, and wonder if they were talking about another person?

      3. WHY WHY WHY is the spelling of his name in any way important to you, so much that you needed to post offtopic to find out?

      Holy shit, I did not know people could be that dumb.

  48. Here's what I think by Anonymous Coward · · Score: 0

    http://www.conhugeco.org/junk/arguing.jpg

  49. And now... by Anonymous Coward · · Score: -1, Offtopic
    For something different!

    183848 random... 77145

    5662 random... 223559

    146916 random... 194053

    48890 random... 112467

    77344 random... 223601

    70998 random... 219295

    145052 random... 119709

    17266 random... 143723

    122520 random... 35017

    83534 random... 176631

    136468 random... 61684

    145962 random... 185539

    175376 random... 127713

    46150 random... 55247

    219084 random... 48781

    31777 random... 50715

    57352 random... 202169

    186366 random... 169063

    197060 random... 23397

    14554 random... 113651

    125568 random... 157585

    49142 random... 123519

    228796 random... 100733

    114450 random... 92107

    132344 random... 195561

    77998 random... 7895

    230772 random... 50389

    57866 random... 84003

    106480 random... 146177

    85734 random... 110191

    136748 random... 99885

    158722 random... 126779

    223656 random... 115993

    213470 random... 87687

    79204 random... 27461

    22458 random... 145555

    132512 random... 125169

    178966 random... 159263

    26460 random... 43357

    204914 random... 56811

    69208 random... 133385

    80142 random... 120439

    41876 random... 193653

    60970 random... 27587

    27984 random... 221281

    187718 random... 146895

    232012 random... 103693

    118370 random... 160347

    77704 random... 72761

    54078 random... 77095

    7172 random... 37989

    199066 random... 18803

    209280 random... 74257

    204854 random... 198591

    33148 random... 195965

    103122 random... 172939

    89336 random... 20073

    124270 random... 215447

    46644 random... 217621

    204938 random... 46755

    83632 random... 155009

    117606 random... 52783

    162860 random... 123117

    222274 random... 92411

    160488 random... 222745

    40862 random... 93639

    151396 random... 105413

    19770 random... 105427

    149984 random... 36081

    182038 random... 38495

    6492 random... 11869

    101426 random... 28203

    158680 random... 202697

    198414 random... 19831

    206228 random... 147765

    159082 random... 209219

    206736 random... 207073

    75590 random... 5967

    27724 random... 135821

    109218 random... 184795

    20552 random... 147129

    75646 random... 60263

    216900 random... 30757

    118874 random... 182451

    147328 random... 60304

    140982 random... 55999

    215036 random... 189693

    87250 random... 213707

    192504 random... 105001

    153518 random... 13335

    206452 random... 131669

    215946 random... 22243

    12080 random... 197697

    116134 random... 125231

    55788 random... 118765

    101762 random... 120699

    127336 random... 38873

    23070 random... 5767

    33764 random... 93381

    84538 random... 183635

    195552 random... 227569

    119126 random... 193503

    65500 random... 170717

    184434 random... 162091

    202328 random... 32264

    147982 random... 77879

    67476 random... 120372

    127850 random... 153987

    176464 random... 216161

    155718 random... 180175

    206732 random... 169869

    228706 random... 196763

    60360 random... 185977

    50174 random... 157671

    149188 random... 97445

    92442 random... 215539

    202496 random... 195153

    15670 random... 229247

    96444 random... 113341

    41618 random... 126794

    139192 random... 203369

    150126 random... 190423

    111860 random... 30357

    130954 random... 97571

    97968 random... 57985

    24422 random... 216879

    68716 random... 222893

    17730 random... 27067

    90344 random... 64280

    30238 random... 190535

    220452 random... 175429

    154106 random... 116883

    93280 random... 78257

    84054 random... 114271

    60188 random... 219165

    102322 random... 197099

    152856 random... 154633

    119630 random... 215607

    135124 random... 158261

    38058 random... 140995

    176912 random... 183969

    36166 random... 39503

    50700 random... 151117

    76514 random... 202011

    116488 random... 151865

    35262 random... 29479

    129475 random... 114213

    220570 random... 106547

    69504 random... 87121

    180278 random... 231615

    143676 random... 151933

    201170 random... 225867

    151864 random... 25961

    67758 random... 177175

    64052 random... 233109

    42570 random... 116707

    89264 random... 50241

    80998 random... 150575

    167532 random... 187309

    75266 random... 25083

    66280 random... 193817

    186654 random... 48391

    136868 random... 49605

    230842 random... 1619

    177696 random... 10993

    118550 random... 201567

    185884 random... 118301

    218418 random... 152875

    98072 random... 92169

    9166 random... 155063

    153300 random... 85237

    153194 random... 32451

    11728 random... 189665

    60101 random... 119119

    128396 random... 100173

    38050 random... 66587

    16584 random... 99001

    101438 random... 139815

    165892 random... 96869

    100506 random... 102643

    150080 random... 229137

    6454 random... 124991

    156348 random... 207805

    118801 random... 212619

    104056 random... 228713

    28590 random... 25687

    85364 random... 168021

    69898 random... 19235

    28272 random... 100609

    127526 random... 173103

    215020 random... 40877

    233154 random... 227835

    27112 random... 42329

    207966 random... 216583

    114980 random... 122757

    139834 random... 109331

    69408 random... 127345

    122581 random... 145119

    43036 random... 18653

    213810 random... 217387

    128024 random... 139401

    47758 random... 81335

    19092 random... 97909

    209066 random... 183363

    231760 random... 92641

    200198 random... 49935

    34252 random... 199949

    66786 random... 1243

    179720 random... 173817

    90814 random... 3431

    1668 random... 166885

    1562 random... 114099

    93376 random... 38033

    141750 random... 200767

    210044 random... 181821

    119698 random... 148235

    98232 random... 180649

    183086 random... 221463

    14260 random... 178517

    182154 random... 184291

    231728 random... 28289

    25446 random... 176623

    62060 random... 134637

    60994 random... 17531

    42408 random... 9625

    225182 random... 79239

    119716 random... 82373

    109050 random... 21907

    152864 random... 229041

    46678 random... 67295

    69852 random... 57949

    156146 random... 195243

    152920 random... 50057

    2574 random... 195511

    79508 random... 55605

    49642 random... 108419

    218256 random... 45793

    710 random... 121167

    47884 random... 86861

    94818 random... 153115

    230792 random... 3129

    225406 random... 63143

    176580 random... 128677

    147674 random... 12531

    193408 random... 115025

    74742 random... 50239

    62396 random... 227133

    29650 random... 86987

    100344 random... 228841

    52718 random... 24855

    45172 random... 56789

    97866 random... 42403

    196400 random... 183297

    84454 random... 102191

    145068 random... 35245

    104642 random... 80379

    225256 random... 67673

    86430 random... 51847

    88484 random... 27141

    78778 random... 30995

    232992 random... 120753

    163030 random... 71327

    13404 random... 148381

    56498 random... 190635

    217432 random... 80009

    49806 random... 823

    5780 random... 154677

    62314 random... 164291

    135888 random... 32545

    186182 random... 90639

    8716 random... 168653

    116130 random... 88027

    208904 random... 76281

    134398 random... 170855

    68292 random... 11749

    151706 random... 189363

    50560 random... 15377

    70134 random... 114751

    92348 random... 41085

    68242 random... 13259

    199416 random... 8233

    108590 random... 175767

    31924 random... 8981

    67338 random... 3235

    44912 random... 204609

    19366 random... 80303

    218220 random... 177517

    212354 random... 205371

    108328 random... 71705

    29981 random... 142279

    222116 random... 22533

    143290 random... 60947

    46944 random... 208561

    151958 random... 200415

    202012 random... 125789

    113586 random... 220843

    79640 random... 116937

    128974 random... 110711

    74388 random... 23605

    82922 random... 83139

    1936 random... 93473

    7110 random... 161167

    6284 random... 176781

    131938 random... 151835

    222792 random... 11449

    160766 random... 9063

    130180 random... 130277

    99354 random... 118771

    157568 random... 124305

    74422 random... 106559

    181116 random... 94333

    74450 random... 133707

    42424 random... 158441

    79278 random... 15894

    222452 random... 115029

    111946 random... 130403

    104880 random... 194497

    212774 random... 146031

    127468 random... 100205

    102402 random... 8058

    123176 random... 71193

    166750 random... 145607

    149604 random... 901

    31418 random... 201555

    74272 random... 111089

    90966 random... 17503

    15260 random... 148317

    161074 random... 74411

    4248 random... 135625

    152462 random... 222519

    38356 random... 113333

    200490 random... 199747

    54224 random... 35361

    17158 random... 72335

    57612 random... 54349

    31586 random... 131163

    175240 random... 29177

    119934 random... 10471

    162308 random... 121125

    123802 random... 61619

    231936 random... 96657

    228214 random... 52991

    231228 random... 43389

    35986 random... 231563

    126584 random... 42921

    115438 random... 183575

    104052 random... 191509

    181706 random... 216483

    118000 random... 218177

    10854 random... 225391

    156908 random... 50925

    144322 random... 95099

    200616 random... 205273

    129950 random... 90567

    38884 random... 125380

    51258 random... 208915

    178592 random... 179889

    112726 random... 153503

    107100 random... 80797

    147314 random... 163371

    210328 random... 23945

    212622 random... 131959

    113876 random... 118772

    176170 random... 47747

    212304 random... 206881

    156038 random... 123855

    88012 random... 69389

    183906 random... 150043

    118279 random... 23097

    23614 random... 166631

    205188 random... 39205

    78362 random... 127539

    60736 random... 183953

    120630 random... 185407

    114044 random... 48381

    43858 random... 199115

    7992 random... 199849

    69806 random... 96663

    50740 random... 56597

    178314 random... 160291

    23408 random... 116865

    159142 random... 67439

    9516 random... 144493

    52610 random... 186747

    213544 random... 76121

    45918 random... 230215

    1892 random... 150789

    58426 random... 160403

    132000 random... 28657

    182294 random... 86751

    4828 random... 164765

    112242 random... 84139

    205016 random... 72393

    130510 random... 166967

    64404 random... 7861

    147818 random... 185475

    46672 random... 11489

    66246 random... 110863

    88460 random... 37197

    64354 random... 9371

    195528 random... 4345

    104702 random... 171879

    28036 random... 5093

    63450 random... 232627

    225088 random... 138065

    218742 random... 133759

    59516 random... 34173

    165010 random... 58187

    36984 random... 182761

    231278 random... 41879

    221556 random... 179413

    117770 random... 178467

    183664 random... 232001

    1382 random... 72879

    218476 random... 225773

    210690 random... 124986

    119144 random... 127640

    76318 random... 11975

    154212 random... 169669

    1466 random... 154323

    35680 random... 184817

    225174 random... 4831

    192668 random... 230685

    174322 random... 122219

    34776 random... 174793

    70670 random... 201207

    103444 random... 135221

    127338 random... 57475

    179792 random... 143649

    134086 random... 68303

    114060 random... 197197

    131234 random... 135771

    110728 random... 232505

    23486 random... 142503

    206020 random... 79397

    189594 random... 99571

    37568 random... 15825

    37942 random... 228479

    184956 random... 118332

    49490 random... 94347

    204664 random... 64361

    74478 random... 160855

    137012 random... 222549

    84106 random... 131363

    169200 random... 71617

    144614 random... 11631

    220588 random... 40685

    80322 random... 161659

    150056 random... 5913

    225310 random... 103367

    118883 random... 42181

    231098 random... 659

    113376 random... 133873

    186710 random... 102687

    92764 random... 177821

    7218 random... 232555

    21976 random... 94793

    153870 random... 21367

    29204 random... 137781

    143338 random... 40835

    75792 random... 18529

    226886 random... 65102

    210700 random... 217997

    202914 random... 117211

    111368 random... 119865

    68542 random... 4199

    146436 random... 161893

    226970 random... 146547

    27904 random... 177041

    217398 random... 230335

    184892 random... 222909

    166546 random... 114443

    27000 random... 167017

    62894 random... 193431

    95668 random... 127445

    119562 random... 49699

    172016 random... 135873

    126310 random... 60527

    106284 random... 189421

    123458 random... 127995

    102952 random... 224729

    64926 random... 197383

    228260 random... 14277

    103354 random... 231251

    24032 random... 88689

    67606 random... 163103

    50460 random... 18397

    165554 random... 219051

    208408 random... 128585

    225102 random... 34999

    149396 random... 165813

    61930 random... 91907

    138384 random... 153121

    53318 random... 6735

    172492 random... 130829

    101346 random... 217243

    188360 random... 52857

    151294 random... 89831

    191748 random... 71845

    165722 random... 148659

    76096 random... 46673

    20790 random... 27967

    63164 random... 138621

    24658 random... 79115

    132792 random... 163369

    191726 random... 100503

    74740 random... 31637

    138954 random... 89251

    162608 random... 112065

    70822 random... 215279

    117036 random... 116652

    53570 random... 17787

    90664 random... 7961

    144798 random... 90055

    175652 random... 128709

    212026 random... 187283

    66720 random... 87217

    140054 random... 56031

    46108 random... 131165

    193842 random... 185899

    24536 random... 110793

    137230 random... 150647

    137364 random... 230581

    140138 random... 137475

    96592 random... 90209

    208326 random... 65743

    98060 random... 213837

    1954 random... 27611

    17928 random... 2425

    209342 random... 184359

    164356 random... 40613

    110490 random... 118387

    85184 random... 126801

    194998 random... 206975

    97212 random... 24829

    36626 random... 118923

    171640 random... 137897

    55854 random... 32791

    141428 random... 5205

    172042 random... 144419

    64175 random... 220033

    10790 random... 96687

    40684 random... 71021

    199938 random... 197755

    189032 random... 4569

    88606 random... 228743

    74340 random... 43717

    54074 random... 39891

    160288 random... 228785

    231702 random... 19743

    87580 random... 17117

    157554 random... 227371

    143768 random... 74505

    178702 random... 36599

    101076 random... 38773

    26090 random... 101187

    138064 random... 209441

    172038 random... 107215

    217292 random... 177549

    43426 random... 146843

    214920 random... 43897

    95294 random... 148071

    205828 random... 159845

    74202 random... 159859

    204416 random... 90513

    3190 random... 92927

    60924 random... 66301

    155858 random... 82635

    213112 random... 23849

    19566 random... 74263

    27380 random... 202197

    213514 random... 30371

    27888 random... 28225

    130021 random... 60399

    82156 random... 190253

    163650 random... 5947

    74984 random... 201561

    130078 random... 114695

    38052 random... 85189

    173306 random... 3603

    201760 random... 114737

    195414 random... 110431

    36188 random... 10845

    141682 random... 34859

    13656 random... 159433

    207950 random... 67767

    27604 random... 186101

    37098 random... 76675

    66512 random... 18849

    170566 random... 179663

    110220 random... 173197

    156194 random... 175131

    181768 random... 93305

    77502 random... 60199

    88196 random... 147813

    138970 random... 4787

    16704 random... 48721

    173558 random... 14655

    119932 random... 225149

    5586 random... 216523

    23480 random... 86697

    202414 random... 132311

    121907 random... 174805

    182282 random... 208419

    230896 random... 221377

    147494 random... 204591

    85228 random... 69485

    143682 random... 207739

    204776 random... 172953

    219550 random... 184007

    156324 random... 217861

    104378 random... 190995

    66592 random... 63089

    140886 random... 96223

    157340 random... 103197

    170674 random... 17771

    175128 random... 153865

    208142 random... 220599

    142996 random... 125813

    103530 random... 1987

    101264 random... 154401

    61318 random... 231695

    187916 random... 122253

    117730 random... 39707

    81864 random... 40441

    143678 random... 170535

    124612 random... 130468

    18906 random... 883

    97280 random... 190737

    233014 random... 92095

    20732 random... 188349

    183826 random... 105803

    147960 random... 106537

    209774 random... 3351

    190708 random... 196565

    85002 random... 66979

    163376 random... 23553

    65830 random... 207407

    149484 random... 51181

    192578 random... 93435

    120232 random... 216089

    185886 random... 136903

    141860 random... 57477

    198394 random... 67091

    38688 random... 168625

    88982 random... 226719

    144796 random... 71453

    18930 random... 224107

    111704 random... 212361

    37198 random... 73655

    204372 random... 147829

    54506 random... 92163

    186640 random... 151457

    206214 random... 17551

    228428 random... 177165

    204322 random... 149339

    102216 random... 144313

    11390 random... 78567

    168004 random... 145061

    203418 random... 139315

    180992 random... 107409

    155446 random... 216383

    121020 random... 80317

    115154 random... 108171

    11128 random... 207785

    166062 random... 45079

    124916 random... 158613

    46090 random... 197027

    183024 random... 111361

    54758 random... 103215

    104812 random... 28589

    16386 random... 123643

    215720 random... 19737

    31774 random... 13511

    210468 random... 159685

    219002 random... 219219

    138016 random... 229553

    143190 random... 63967

    142364 random... 79581

    34738 random... 54635

    125592 random... 147529

    63566 random... 145143

    32980 random... 33077

    2154 random... 21571

    60368 random... 27105

    210502 random... 9359

    83916 random... 230413

    210530 random... 36507

    178504 random... 61241

    215358 random... 151975

    125252 random... 17829

    14745 random... 33203

    7680 random... 97297

    115574 random... 48831

    30268 random... 3005

    5202 random... 144139

    25976 random... 207273

    69550 random... 48407

    52404 random... 136981

    167498 random... 104355

    210352 random... 13889

    227046 random... 153583

    151340 random... 51117

    63874 random... 210491

    140328 random... 38425

    55262 random... 125319

    174436 random... 16133

    103290 random... 102547

    190304 random... 171441

    153238 random... 208415

    193692 random... 190429

    167666 random... 33963

    78040 random... 165257

    22734 random... 146551

    65108 random... 23925

    26602 random... 197699

    134736 random... 48673

    193670 random... 219087

    76684 random... 150221

    140898 random... 207835

    164552 random... 230649

    72766 random... 100583

    118980 random... 1957

    55514 random... 136371

    92608 random... 126545

    146742 random... 208639

    177596 random... 14013

    213970 random... 72587

    68664 random... 205801

    141998 random... 174615

    48052 random... 16469

    195786 random... 71203

    26480 random... 229377

    139174 random... 35951

    139308 random... 115885

    142082 random... 22779

    98536 random... 208793

    210270 random... 184327

    100004 random... 99141

    3897 random... 146195

    19872 random... 121009

    211286 random... 69663

    166300 random... 159197

    112434 random... 3691

    87128 random... 12105

    196942 random... 92279

    99156 random... 143413

    38570 random... 4227

    173584 random... 23201

    57798 random... 151375

    143372 random... 123789

    173986 random... 29723

    66120 random... 105337

    12734 random... 215271

    42628 random... 189605

    201882 random... 83059

    190976 random... 123153

    90550 random... 114047

    76284 random... 162301

    56018 random... 158475

    162232 random... 114089

    366 random... 187543

    152180 random... 165717

    102154 random... 34211

    51888 random... 3265

    90662 random... 222639

    221356 random... 185453

    75330 random... 153787

    182504 random... 173721

    131038 random... 179015

    148452 random... 17029

    38906 random... 96723

    142240 random... 92657

    115734 random... 137311

    204188 random... 69405

    99442 random... 4139

    54936 random... 125832

    56270 random... 169527

    80404 random... 224501

    43818 random... 60355

    139472 random... 8289

    162886 random... 131663

    160140 random... 18637

    64993 random... 130011

    191368 random... 36665

    15102 random... 78439

    143876 random... 145893

    10330 random... 17267

    153024 random... 84241

    220598 random... 133695

    164092 random... 151229

    185106 random... 113803

    139640 random... 171177

    30574 random... 49751

    189108 random... 11605

    212042 random... 102819

    154096 random... 23873

    9510 random... 88687

    49004 random... 6381

    145858 random... 151355

    190632 random... 189529

    194846 random... 192903

    83620 random... 43397

    110394 random... 158611

    27488 random... 40305

    45142 random... 11039

    79836 random... 73693

    91250 random... 92907

    108184 random... 132041

    176718 random... 12535

    230612 random... 195189

    117225 random... 17603

    12240 random... 52897

    56774 random... 191631

    150028 random... 212045

    130722 random... 39259

    114056 random... 159993

    51070 random... 93287

    143364 random... 49381

    13658 random... 178035

    131392 random... 205649

    127926 random... 161023

    66620 random... 90237

    2194 random... 160331

    162168 random... 218665

    117422 random... 207639

    207796 random... 35093

    90570 random... 66787

    10544 random... 141441

    126118 random... 140975

    224172 random... 16429

    57026 random... 202683

    68200 random... 89177

    174174 random... 145351

    101348 random... 2565

    111802 random... 190739

    18336 random... 64753

    221270 random... 85407

    101404 random... 56861

    67698 random... 85675

    27992 random... 62408

    114766 random... 231863

    117524 random... 223221

    35818 random... 68675

    74832 random... 187489

    116486 random... 133263

    111820 random... 124877

    29154 random... 139291

    191048 random... 92985

    133822 random... 178919

    188676 random... 192613

    185690 random... 180147

    179584 random... 75281

    164598 random... 191935

    178172 random... 5949

    93586 random... 125003

    34680 random... 215017

    12974 random... 114711

    186868 random... 172565

    109962 random... 106339

    1136 random... 117633

    70630 random... 62447

    1644 random... 176941

    220418 random... 92475

    55912 random... 105689

    20766 random... 38023

    48740 random... 116997

    220474 random... 146771

    11808 random... 625

    30421 random... 35679

    175516 random... 30172

    52530 random... 142507

    9944 random... 159561

    232078 random... 17719

    158036 random... 44853

    122410 random... 178307

    95184 random... 58081

    217478 random... 41295

    155212 random... 139469

    213666 random... 44443

    41480 random... 9657

    56254 random... 20711

    226308 random... 54565

    174362 random... 27699

    136576 random... 133073

    210870 random... 166207

    227324 random... 173181

    7378 random... 87755

    11832 random... 223849

    44846 random... 57303

    212980 random... 195797

    173514 random... 71971

    171248 random... 224385

    131302 random... 68399

    73836 random... 21613

    217730 random... 52347

    73384 random... 16601

    23838 random... 150535

    28772 random... 85509

    116986 random... 118163

    101280 random... 69937

    148694 random... 168351

    106588 random... 217565

    150642 random... 90859

    188696 random... 145353

    119949 random... 159287

    16404 random... 57781

    226538 random... 94275

    1552 random... 21089

    9606 random... 48463

    106700 random... 92877

    62434 random... 114011

    208008 random... 140665

    140222 random... 218919

    147076 random... 49253

    222810 random... 178867

    171584 random... 83601

    99958 random... 137855

    131772 random... 7548

    45266 random... 231243

    182904 random... 161641

    215918 random... 228375

    150772 random... 133589

    111306 random... 9763

    109040 random... 162177

    69094 random... 6191

    11628 random... 192685

    155522 random... 223419

    11176 random... 187673

    194910 random... 88327

    199844 random... 23301

    54778 random... 55955

    39072 random... 7729

    86486 random... 106143

    44380 random... 155357

    88434 random... 28651

    126487 random... 83145

    57742 random... 97079

    187476 random... 228853

    164330 random... 32067

    172624 random... 192161

    180678 random... 219535

    44492 random... 30669

    226 random... 51803

    145800 random... 78457

    78014 random... 156711

    84868 random... 220325

    160602 random... 116659

    109376 random... 21393

    37750 random... 75647

    69564 random... 178621

    216338 random... 169035

    169912 random... 162089

    183726 random... 108823

    10100 random... 210837

    92554 random... 90851

    114288 random... 218305

    34982 random... 224559

    116715 random... 172973

    172290 random... 118267

    135464 random... 54681

    86878 random... 19655

    202212 random... 119749

    156026 random... 12243

    80800 random... 175217

    48534 random... 67231

    174428 random... 175005

    176242 random... 17579

    22296 random... 38473

    35150 random... 154167

    217684 random... 91061

    201258 random... 111235

    49232 random... 27489

    49606 random... 6863

    196620 random... 129997

    61154 random... 106011

    216328 random... 76025

    86142 random... 172519

    148676 random... 933

    95770 random... 143027

    180864 random... 83281

    156278 random... 23295

    232252 random... 3133

    29329 random... 143307

    219064 random... 96041

    97518 random... 71575

    220532 random... 219669

    124426 random... 33443

    140400 random... 8257

    98534 random... 190191

    53548 random... 46445

    232962 random... 75003

    145000 random... 102617

    141534 random... 57991

    80228 random... 220485

    15802 random... 57299

    175776 random... 115633

    131029 random... 104607

    221404 random... 165341

    104178 random... 197035

    Ok, so they're not random, but pseudo-random. Sue me. Or lick me. Whichever works for you.

    Oh yeah, fuck Slashdot. Their 2 minute limit hinders my enjoyment of the site.

    I've got to start trolling more and crapflooding less, ya know...

    Replies are MUCH more satisfying than long scrolls...

    Christ, 2 minutes is a long time...

    1. Re:And now... by Anonymous Coward · · Score: 0

      keep up the good work

    2. Re:And now... by Anonymous Coward · · Score: -1, Offtopic

      All these random numbers make me want to

      +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+
      * \ |\ \ *
      j | / \ \ j
      a | | \ \ a
      c | | \ \ __ c
      k / \ \ \/__|__,,..---v--. k
      o | |__,,\.--"""\/ | \ o
      f | | \ _> f
      f| | _ _ _ _ | / f
      *| | /_v_v_v_\..---""'`-' *
      j| | __,,.| | | | | j
      a| / \ \_h_h_h_/ a
      c | | | c
      k | | | k
      o \ |\ | o
      f \ | \___/ f
      f \ | f
      * \ | *
      j | | j
      a | | a
      c | | c
      k | | k
      o | | o
      f | | f
      f | | f
      * | | *
      +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+


      Please try to keep posts on topic.
      Try to reply to other people comments instead of starting new threads.
      Read other people's messages before posting your own to avoid simply duplicating what has already been said.
      Use a clear subject that describes what your message is about.
      Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page) keep posts on topic.
      Try to reply to other people comments instead of starting new threads.
      Read other people's messages before posting your own to avoid simply duplicating what has already been said.
      Use a clear subject that describes what your message is about.
      Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on theother people comments instead of starting new threads.
      Read other people's messages before posting your own to avoid simply duplicating what has already been said.
      Use a clear subject that describes what your message is about.
      Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page)
      Problems regarding accounts or
      User Preferences Page)
      Problems regarding accounts or comment posting should be sent to CowboyNeal.

      Problems regarding accounts or comment posting should be sent to CowboyNeal.

    3. Re:And now... by Anonymous Coward · · Score: 0

      Hey Taco, ban this motherfucking troll's IP, wouldja?

      Jesus Motherfucking Christ, that is some annoying shit.

  50. What is this world coming to? by Anonymous Coward · · Score: -1, Troll

    Now we're actually punishing criminals. This is terrible. How can we as a society tolerate this? Sure, there are thinly veiled attempts to dismiss this case becuase the offending software was distributed to the US from outside the US. And they almost sound like the protesters have convinced themselves they're in the right. Next thing you know they'll be arresting people who traffic drugs in the US that are CLEARLY grown outside the US, and therefore immune from our silly laws.

    We need to FREE DMITRI and all our other criminals, as they are victims of an unjust system that treats people differently just because they committed a crime.

    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    No Justice? NO PEACE!
    etc. etc.

  51. Shouldn't that be "law VS guilt"? by _Mustang · · Score: 2

    Don't proclaim Sklyarov's innocence, because he isn't. Instead, proclaim the injustice of a law that imposes draconian punishments for things that should not be illegal in the first place.

    If all that was needed to institute change was people "proclaiming" against immoral unethical laws then you folks in the US of A would still be a colony of the Brits. The fact that actions speak louder than words and that action is often the only way to effect change *was* the whole point of the Boston Tea party I believe..

    As I see it, the only unfortunate aspect is that it's a non-US citizen involved; an American in his place would have been a much better symbol of how slippery the slope has become.

  52. Urge to kill.....rising.... by Sarcasmooo! · · Score: 1, Offtopic

    How is this legal? The action of monitoring people and their 'transgressions' may be done by advertisers and websites all the time, but at the very least they've been required to post a privacy policy, or an opt-out arrangement. Required might be an assumption, maybe they just know better than to cross that line of complete deception and risk legal action.

    (This is offtopic, I know. I got to the ranger site from the salon article linked by the 'cute fable')

    1. Re:Urge to kill.....rising.... by timmy+the+large · · Score: 1
      That is just plainscary.

      Who starts these companies. Someone has to program this stuff, its not just some faceless corporation. There is some guy out there thinking up better ways to patrol the internet. This guy probably thinks he's a good guy.

  53. (s core: -999, OFFTOPIC, not goat related) by Anonymous Coward · · Score: 0

    "ok, so I'm lying. At least it't not goat related."

    Freakin' holier-than-thou meta-troll!

    Just to bring this thread on topic:

    GOATapalooza! Goats! Goats! Goats!

    All models are real goats, not like that other link

    100% free goat pr0n, no annoying popup windows

  54. You've got to admire his boss... by brulman · · Score: 5, Insightful

    for showing up in court yesterday to stand by his employee. He certainly didn't have to come all the way from Russia, and risked getting arrested himself to do so. It impressed me a great deal, and hopefully it will have a similar effect on the court.

    --
    "the best safety of the frontier...will be secured by total annihilation of the few remaining indians" L Frank Baum 1890
    1. Re:You've got to admire his boss... by Anonymous Coward · · Score: 0

      I sure no Adobe executive would do the same for any employee of theirs that ran afoul of some troglodyte Russian law.

    2. Re:You've got to admire his boss... by Anonymous Coward · · Score: 0

      Are Adobe eBooks illegal in Russia because they cannot be backed up?

    3. Re:You've got to admire his boss... by fishbowl · · Score: 2

      >He certainly didn't have to come
      >all the way from Russia, and risked getting
      >arrested himself to do so.

      I think it would be reasonable to demand that he
      is also arrested, regardless of where you stand on the DMCA. Equal protection of the law is not served by selectively enforcing it.

      --
      -fb Everything not expressly forbidden is now mandatory.
    4. Re:You've got to admire his boss... by Maserati · · Score: 1
      That's a damned good point. Someone from the business side is much closer to trafficking.


      On a personal level for Sklyarov, this gets him (another) possibility for appeal.

      --
      Veteran, Bermuda Triangle Expeditionary Force, 1992-1951
    5. Re:You've got to admire his boss... by Brian+Stretch · · Score: 2
  55. Beowolf by Anonymous Coward · · Score: -1, Offtopic

    Dude, can you make a beowolf cluster of these guys?

    1. Re:Beowolf by anichan · · Score: 0, Offtopic

      A beowolf cluster of lawers? Wouldn't that yeild the Micro$oft legal team?

      --

      karma is for the weak >)

    2. Re:Beowolf by Anonymous Coward · · Score: 0

      Good point. But if we sicked them on the Micro$ucks team, they would probably destroy the entire legal system, thus allowing anarchy to rule. Take that DMCA!

  56. not enough thinking by Anonymous Coward · · Score: 0
    I'd say you have more thinking to do.



    Violating Slashdot's copyright and making a legal program to promote a legal right in a country that is not bound by the idiocy of the DMCA to enforce the legal creation of legal backup copies of a product are very different things.



    Now, if Slashdot were selling compilation CD's with all the Slashdot archives on them, included a proprietary reader that prevents you from making copies or backups of the compilation and prevented you from using the CD on any other machine or in two places at once (even though you may only be accessing one of the isntances at a time) and someone offered a way to get around that so you could make a backup copy of it (since you are licensing the right to read the archives on a convenient disk, you shouldn't have to pay for those rights all over again if the disk is corroded, melted, scratched, etc) and Slashdot sued or attacked that person... then you'd have something.

  57. Exclusive! Adobe CEO pic! by Anonymous Coward · · Score: -1, Troll

    Candid photo of Adobe CEO. This pretty much sums up the Adobe side of the story.

  58. Not guilty plea *was* the right thing to do by M_Talon · · Score: 5, Informative

    To those who were criticizing the not-guilty plea and saying he is guilty, this needs to be said. Had he went ahead and pleaded guilty, there would be no legal examination of the DMCA. He would have been fined and sentenced to prison, end of story. The United States NEEDS this examination of the DMCA, if for no other reason than to bring the flaws in the law to light in an official manner. It will be up to the courts to make the decision, and in the mean time, the issues surrounding the DMCA will hopefully become more public knowledge.

    I'm really saddened that Russia had to issue its advisory, but again maybe that will be a wake up call to everyone that there is something very very wrong with the way the DMCA is being enforced. One would hope that we can settle the issue internally before it becomes more of an international issue than it already is. The US preaches so much about "human rights" and begs for other countries to "do the right thing" even though their laws are written differently. It's time we practice what we preach.

    --
    Electronic Frontier Foundation for online civil rights information
    1. Re:Not guilty plea *was* the right thing to do by Anonymous Coward · · Score: 0

      Yo, mod parent up.

    2. Re:Not guilty plea *was* the right thing to do by Col.+Panic · · Score: 1

      Well, OK but do you think Dmitri gives a rat's ass about whether the DMCA is overturned as a result of his case? He is [correctly] pleading not guilty to save his ass, if possible. Ass ass ass - there I said it again :P

    3. Re:Not guilty plea *was* the right thing to do by psychonaut · · Score: 1
      To those who were criticizing the not-guilty plea and saying he is guilty, this needs to be said. Had he went ahead and pleaded guilty, there would be no legal examination of the DMCA.

      Unfortunately, a plea of not guilty will not lead to a legal examination of the DMCA either, at least not directly. The court's duty is to enforce the existing law, not to ratify or amend it. As I understand American law, the judge is not at liberty to simply say, "Well, this law is clearly unfair. Therefore we'll just have to release Mr. Skylarov." His only duty is to determine whether or not Skylarov violated the DMCA, and issue an appropriate sentence.

    4. Re:Not guilty plea *was* the right thing to do by rjh · · Score: 5, Informative
      The court's duty is to enforce the existing law, not to ratify or amend it. As I understand American law, the judge is not at liberty to simply say, "Well, this law is clearly unfair. Therefore we'll just have to release Mr. Skylarov."

      Are you high?!

      That was, honestly, my first gut response to your message. You're operating under a critical, severe misunderstanding of how American jurisprudence works.

      1. The Constitution is the supreme law of the land.
        No ifs, ands or buts here. The Constitution is this nation's highest law; so high, in fact, that it automatically trumps any other law which comes into conflict with it.
      2. No unconstitutional laws exist.

      3. This is actually a little judicial fiction that lawyers tell themselves, because unconstitutional laws are passed on a regular basis. However, the instant that a judge finds a law to be in conflict with the Constitution--i.e., there's a formal finding by a court that a law is inconsistent with the nation's highest law--then the law in question is not merely voided. If it were voided, that would mean at one point it was enforceable. Laws which are held to be unconstitutional are retroactively erased; they are invalid ab initio, from the very beginning. Is the law unconstitutional? If so, then that law doesn't exist and, more to the point, never existed in the eyes of the court.
      4. The judge must uphold the law.
        A judge is responsible for seeing to it that the laws are properly applied--including the Constitution, the nation's highest law. A judge who will not judge laws for Constitutional correctness is a judge who is utterly incompetent for the bench, and who needs to be impeached.
      ... If the DMCA violates any of Dmitry's rights under the Constitution--and note that he has a hell of a lot of rights, even though he's a foreigner--then that's it; game over; prosecution loses.
    5. Re:Not guilty plea *was* the right thing to do by psychonaut · · Score: 1
      [T]he instant that a judge finds a law to be in conflict with the Constitution--i.e., there's a formal finding by a court that a law is inconsistent with the nation's highest law--then the law in question is not merely voided. If it were voided, that would mean at one point it was enforceable. Laws which are held to be unconstitutional are retroactively erased; they are invalid ab initio, from the very beginning. Is the law unconstitutional? If so, then that law doesn't exist and, more to the point, never existed in the eyes of the court.

      I find it hard to believe that it's that simple. Do you have a cite? How do the courts deal with issues of jurisdiction? Can a state court find a federal law unconstitutional? If so, is the law erased everywhere, or just in that state?

      I know that under Canadian law (which, like American law, is based on British law), when a provincial court finds a law unconstitutional, it is not stricken from the Criminal Code, but is merely made unenforceable in that province. Such is the case with the federal law against sodomy. An Ontario court ruled it unconstitutional, but it's still on the books, and you can still be prosecuted for it in the other provinces and territories. (While your lawyer will argue that Ontario has set a precedent, the judge is under no obligation to follow it.)

      I think you'll need to back up your claim that the DMCA will simply vanish if Skylarov is acquitted on the basis of unconstitutionality. Things are rarely that simple in the legal system.

    6. Re:Not guilty plea *was* the right thing to do by rjh · · Score: 2

      I find it hard to believe that it's that simple

      It is. But by all means, look up the principles of Constitutional law in an (American) law library of your choosing.

      Do you have a cite?

      Only in treeware form. If you have access to Black's, I'd suggest starting your search there. I'll look around for Web-based cites, if you like.

      How do the courts deal with issues of jurisdiction?

      The exact same way they deal with every other issue of jurisdiction.

      Can a state court find a federal law unconstitutional?

      No. State courts can find state law to be in violation of the state constitution, and the Federal courts can find state or Federal law to be in violation of the Federal Constitution.

      Yes, each and every state in the Union has its own Constitution, just as the nation has a Constitution.

      is the law erased everywhere, or just in that state?

      Depends on the jurisdiction of the court in question. Let's take Iowa as an example (for the sole reason that I know the legal districts). There are two regions of Federal jurisdiction in Iowa, the Northern and the Southern Districts. If a judge in the Northern District declares a law to be unconstitutional, then the law is void ab initio everywhere in the Northern District of Iowa--but it's in full force in the Southern District of Iowa, as well as the rest of the country.

      Let's say the government appeals that verdict to the Eighth Circuit Court of Appeals, which operates primarily out of St. Louis, Missouri or St. Paul, Minneapolis (they keep offices in both places). The Eighth Circuit has a jurisdiction that covers most of the central United States. Iowa, Minnesota, the Dakotas, Missouri, Arkansas, etc. Let's say the Eighth Circuit affirms the lower court and agrees that the law is unconstitutional.

      Suddenly the law is nullified, ab initio, throughout the entire scope of the Eighth Circuit's jurisdiction.

      If the government wants to appeal it from there, it goes to the Supreme Court (and there's no guarantee they'll hear the case; the Supreme Court is permitted to refuse to hear appeals, mostly due to the enormous number of requests they get). If the Supreme Court finds that the law is unconstitutional, then the law is nullified ab initio throughout the entire United States, plus its associated territories like Guam, the Virgin Islands, Puerto Rico, etc.

      which, like American law, is based on British law

      I beg your pardon. American law is not based upon British law. We incorporated the whole body of English common law into American common law after we won our independence, but our legal traditions are not British in origin. In Louisiana, much of the law owes more to the Napoleonic Code than to English courts.

      There are strong (very strong!) similarities between American and British courts, but I wouldn't say American law is ``based upon'' British law.

      British law, for instance, has no concept--no concept at all--of rights which belong to free people which no government can lawfully or morally deprive. American law is rife with them; the entire Bill of Rights, for instance.

      An Ontario court ruled it unconstitutional, but it's still on the books, and you can still be prosecuted for it in the other provinces and territories.

      But you can't be prosecuted for it in Ontario, where it's been found null ab initio. :)

      Jurisdictional issues. Remember them.

    7. Re:Not guilty plea *was* the right thing to do by psychonaut · · Score: 1
      American law is not based upon British law. We incorporated the whole body of English common law into American common law after we won our independence, but our legal traditions are not British in origin. In Louisiana, much of the law owes more to the Napoleonic Code than to English courts.

      But Louisiana is not the federal government. You could just as well argue that Canadian law is based on civil law and not common law because of Quebec. Civil law is not practiced in Canada anywhere outside Quebec.

      Historically speaking, US law is basically British, as opposed to the civil (Roman) law prevalent in most of Western Europe. I am not saying that the legal systems of America and Britain are identical, but rather that there is a strong ancestral relation between the two.

    8. Re:Not guilty plea *was* the right thing to do by rjh · · Score: 2
      Historically speaking, US law is basically British, as opposed to the civil (Roman) law prevalent in most of Western Europe. I am not saying that the legal systems of America and Britain are identical, but rather that there is a strong ancestral relation between the two.

      Which is true, as far as it goes. It is not true to say that the courts are based upon a British model. For instance,

      • Review of Law
        In England, courts do not review law to determine whether the laws themselves are legal. England lacks a Constitution, which means Parliament can pass essentially anything which pleases it.
      • Evidentiary Procedure
        In American courts, the judge's only role in evidentiary procedure is to determine whether or not something is admissible as evidence--whether that be material evidence, or the evidence as given by an eyewitness. In British courts, the judge receives considerable leeway to tell the jury ``you may trust this if you like, but I certainly wouldn't''.
      • Courts of Law versus Courts of Equity
        In America, every court of law is a court of equity as well. I'm uncertain as to whether they've been unified in British courts, but at the time America separated from Great Britain, British courts were separated along those two lines.
      • Status of the Judiciary
        In America, the judiciary is explicitly granted co-equal status with the Legislature and the Executive. President Bush makes the news a fair bit and the Speaker of the House slightly less so, but most people don't understand that Chief Justice Rehnquist is co-equal to them in the grand scheme of things.
      ... I could go on, but you get the idea. While there's an awful lot of shared history there, the United States Judiciary is not based upon an English model--it is its own separate entity. It has adopted much from the practices of English courts, but that doesn't make it ``based upon'' English courts any more than a Chevy is ``based upon'' a BMW just by virtue of having four wheels, an engine and a steering column. :)
    9. Re:Not guilty plea *was* the right thing to do by psychonaut · · Score: 1
      While there's an awful lot of shared history there, the United States Judiciary is not based upon an English model--it is its own separate entity.

      Well, the Americans didn't exactly pull their legal system out of a hat. While it has a number of innovations, its creators could not simply ignore two hundred years of colonial legal precedent.

      Some of the contrasts you cite are details and not fundamental differences. For instance, the difference between the judges' roles in the two systems is negligible compared to that with the judge's role under Soviet-style law, where he is an inquisitor charged with gathering evidence. IIRC even in civil law, the judge has inquisitional powers which he may choose to invoke if he feels the prosecution or defence has failed to gather sufficient evidence. For that matter, some legal systems do not even use the adversarial system.

      Also keep in mind that the rules governing which side has the burden of proof are very similar under both common and American law, but not under civil or Soviet law. This is not a historical accident, nor is it a necessity of construction as with your automobile example. Almost every car ever made has had four wheels, an engine, and a steering column.

    10. Re:Not guilty plea *was* the right thing to do by rjh · · Score: 2

      For instance, the difference between the judges' roles in the two systems is negligible compared to that with the judge's role under Soviet-style law, where he is an inquisitor charged with gathering evidence. IIRC even in civil law, the judge has inquisitional powers which he may choose to invoke if he feels the prosecution or defence has failed to gather sufficient evidence

      You mean, like the United States courts do?

      Check out John Sirica, a United States Federal judge who had the misfortune of hearing the Watergate case. When the government prosecutors went easy on witnesses (in order to protect Nixon), Sirica started interrogating witnesses himself in order to get to the bottom of things.

      The White House complained mightily about ``Maximum John's'' method of handling his courtroom, but the Supreme Court backed Sirica up every step of the way.

      Just because Federal judges rarely invoke their right to conduct interrogations doesn't mean they lack that power.

    11. Re:Not guilty plea *was* the right thing to do by psychonaut · · Score: 1
      Just because Federal judges rarely invoke their right to conduct interrogations doesn't mean they lack that power.

      I wasn't talking about interrogations; I was talking about the inquisitional judiciary system. Yes, American judges have the right to question witnesses who are already on the witness stand. So do Canadian judges, and (I would assume) British judges. It is not their prerogative, however, to conduct an independent investigation to gather physical evidence, subpoena witnesses, etc. as it is under Finnish and Soviet law.

      Again, you are arguing minor details here, but my point of contention has always been fundamental differences. If you were to draw up a taxonomy of legal systems, the American legal system is going to be placed in or near the "common law" category because that it whence it derives most of its procedures, particularly those relating to the gathering and presentation of evidence in a trial. Also in the common law area will be found the British system, since common law arguably began there. Many of its developments, such as were effected by the Magna Carta, are still in evidence in American jurisprudence.

    12. Re:Not guilty plea *was* the right thing to do by rjh · · Score: 2

      It is not their prerogative, however, to conduct an independent investigation to gather physical evidence, subpoena witnesses, etc. as it is under Finnish and Soviet law.

      Please read up on Judge John Sirica's actions during Watergate. You might be extremely surprised by what you learn.

      but my point of contention has always been fundamental differences

      Sure, as long as you define ``fundamental differences'' narrowly enough. Every time you make an assertion about American courts, I show a historical situation which shows you're wrong, and you go about decrying it as ``insignificant''. Well, of course they're insignificant, as long as you're the one who gets to dictate what's significant. I'm not inclined to let you, though. :)

      If you were to draw up a taxonomy of legal systems, the American legal system is going to be placed in or near the "common law" category because that it whence it derives most of its procedures, particularly those relating to the gathering and presentation of evidence in a trial

      Oh, why stop there? After all, both Finnish and American courts inherit from the Code of Hammurabi and Justinian's Code, so there are no significant differences between them, right? After all, they both inherit from the same places.

      Or, alternately, they're related because Gustavus Adolphus had a significant role in forming both. Gustavus' dream of a Corpus Evangelicorum may not have come true in his life, but he certainly had a tremendous effect in how Scandiavian and German governments were arranged and organized. Many of Gustavus Adolphus' developments were borrowed by Americans and English later, so doesn't that mean they're all related?

      Etc.

      You get the idea. Whether or not the American legal system is ``based on'' the British legal system is true only if you take an idiosyncratic view of what it means to be ``based on''. The American legal system stands on its own, with influence from other systems, most notably the British--but that doesn't make American courts ``based on'' British courts.

      Think about Linux for a moment. Is Linux ``based on'' SunOS? Is it ``based on'' SVR4? Is it ``based on'' FreeBSD? No. It borrows from all of the above plus some, but it stands on its own, independent and co-equal to those from whom it borrowed.

    13. Re:Not guilty plea *was* the right thing to do by psychonaut · · Score: 1

      Look, buddy. Your own friggin' government disagrees with you:

      http://www.cia.gov/cia/publications/factbook/geos/ us.html

      Scroll down to the section on government.

    14. Re:Not guilty plea *was* the right thing to do by rjh · · Score: 2

      Mmmhmm. Real good idea, asking an intelligence agency for an informed opinion on the judicial branch. The CIA is not what I would consider an authority on what the United States legal system is.

      The Federal judge I had dinner with two nights ago, on the other hand, is an authority.

      The US legal system is not ``based on'' the English system any more than the US Constitution is ``based on'' the English constitution. Yes, it's true that virtually everything in the Bill of Rights was recognized as a right of a free Englishman; yes, it's true that the Senate/House split is reminiscent of the House of Lords/House of Commons split; but it's not true that the US Constitution is based on the English constitution because England doesn't have a constitution in the first place.

      Similarity does not mean ``based on''. The simple Constitutional fact alone is enough to make the US legal system stand independent.

      Linux is similar to SysV and BSD. Does that mean it's ``based on'' either?

    15. Re:Not guilty plea *was* the right thing to do by psychonaut · · Score: 1
      Mmmhmm. Real good idea, asking an intelligence agency for an informed opinion on the judicial branch. The CIA is not what I would consider an authority on what the United States legal system is.

      Why, yes, of course. How silly of me -- everyone knows that intelligence agencies pull their facts out of thin air.

      The Federal judge I had dinner with two nights ago, on the other hand, is an authority.
      Well, too bad you didn't ask him about our little discussion, or you might actually have learned something. Luckily, this federal judge has already written extensively on the topic.
      Similarity does not mean ``based on''.

      So your argument is, what? That the Americans developed their legal system, which is remarkably similar on a high level to the British system of common law, completely independently?

      Linux is similar to SysV and BSD. Does that mean it's ``based on'' either?
      That's a terrible analogy and you know it. SysV and BSD are variants of Unix, which was invented decades ago (and has been in a continuous process of revision ever since). Linux, meaning the operating system and not the mere kernel, is a relatively modern invention and is based on Unix. Despite his trollish appearance, Richard Stallman did not live in a hole in the ground, sheltered from the rest of the universe, and magically create a near-complete operating system that just happened to resemble Unix. Sure, there are some parts of Linux which are not wholly Unix-based, such as Torvalds's kernel (which is instead derived basically from MINIX). But the vast majority of the basic OS was written by looking at existing Unices and copying their functionality, adding new features or removing others as need required. If you don't believe me, go read the literature on the FSF web page. They are quite upfront in admitting that the GNU programs comprising what is known as the Linux OS are based on their Unix counterparts.
  59. The DMCA makes me want to by Anonymous Coward · · Score: -1, Troll

    The DMCA makes me want to

    +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+
    * \ |\ \ *
    j | / \ \ j
    a | | \ \ a
    c | | \ \ __ c
    k / \ \ \/__|__,,..---v--. k
    o | |__,,\.--"""\/ | \ o
    f | | \ _> f
    f| | _ _ _ _ | / f
    *| | /_v_v_v_\..---""'`-' *
    j| | __,,.| | | | | j
    a| / \ \_h_h_h_/ a
    c | | | c
    k | | | k
    o \ |\ | o
    f \ | \___/ f
    f \ | f
    * \ | *
    j | | j
    a | | a
    c | | c
    k | | k
    o | | o
    f | | f
    f | | f
    * | | *
    +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+


    Important Stuff:
    Please try to keep posts on topic.
    Try to reply to other people comments instead of starting new threads.
    Read other people's messages before posting your own to avoid simply duplicating what has already been said.
    Use a clear subject that describes what your message is about.
    Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page)
    Problems regarding accounts or comment posting should be sent to CowboyNeal.

  60. karma whore.... by metalhed77 · · Score: 0

    you should be shot and killed, you greedy karma whore,

    --
    Photos.
  61. Does anybody know the law here? by Ami+Ganguli · · Score: 2

    Ok, the above comment is an obvious troll, but I'm curious about how American law actually works. Do they really think they can enforce their own laws globally? This strikes me as really bizarre. I know the French did something similar with Yahoo, but presumably Yahoo at least has an office or something in France (I don't really know, I'm just guessing).

    Any lawyers who know better?

    --
    It is tempting, if the only tool you have is a hammer, to treat everything as if it were a nail. - Abraham Maslow
    1. Re:Does anybody know the law here? by FatalException · · Score: 1

      We can't enforce our laws globaly, but if you step foot on US soil we will.

    2. Re:Does anybody know the law here? by Ami+Ganguli · · Score: 2

      Does this apply to all laws? Could I technically be charged in the U.S. if I assaulted somebody in Russia?

      I know this doesn't happen, but is that just because they don't bother, or because they can't?

      --
      It is tempting, if the only tool you have is a hammer, to treat everything as if it were a nail. - Abraham Maslow
    3. Re:Does anybody know the law here? by Gonarat · · Score: 2, Insightful

      If you are a big enough target, it doesn't matter where you are. Look at Manuel Noriega -- he was arrested for Drug Trafficing while he was physically in Panama and brought back to Miami by the U.S. Military to face charges. He is currently in a U.S. jail. I'm not commenting on Noriega's crimes, just that Panamanian Sovereignty did not matter.

      --
      Beware of Sleestak
    4. Re:Does anybody know the law here? by Garc · · Score: 1
      Could I technically be charged in the U.S. if I assaulted somebody in Russia?

      No, but you could be charged in Russia, which is the point. An agent of elmsoft (company based on the west coast of USA) sold and distributed the product. So, back to your analogy, if you contract someone to commit a murder, you are subject to the anti-murder laws in Russia. Should it be any other way?

      IANAL, so this is all IMHO.

      garc

    5. Re:Does anybody know the law here? by hearingaid · · Score: 2

      it's a valid question.

      one of the few countries that's worse than the Americans is Turkey. under Turkish law, if you kill a Turkish citizen anywhere in the world, you can be prosecuted - should you happen to visit Turkey. yes, this has really happened. double jeopardy? who cares...

      --

      my old sig used to be funny, but then slashcode ate it and now it's not funny anymore

  62. sorry, but nope by Seumas · · Score: 2, Insightful

    Sorry, but if it was a non-american involved, he would still be ignored by the public and the media. Any little attention he would manage to receive would be with the accusation that he is a rampant cracker and criminal spawned by bullying through his highschool years and society's general lack of morality, yadda yadda yadda.

    American's don't care about things unless it affects their religion, the children or their cable television prices.

    1. Re:sorry, but nope by jallen02 · · Score: 2

      You left out the price of gas

      Excursions are expensive to fill to the hilt with gas.

      Jeremy

    2. Re:sorry, but nope by flatrock · · Score: 2

      You left out Guns.

    3. Re:sorry, but nope by Anonymous Coward · · Score: 0

      I'm assuming that you were bullyed as a kid, and now see the entire world from the eyes of a victim. It must be difficult convincing yourself that everyone, including an entire country is against you. You must be very ignorant in order to do this.

      Very sad

  63. Huh ? by Anonymous Coward · · Score: -1, Troll

    > one more link - the Russian Foreign Ministry has warned its programmers not to travel to the United States.

    Why would anyone want to go there ?
    To see a bunch of fat and stupid people ?
    .

    1. Re:Huh ? by Dr.+Awktagon · · Score: 1, Flamebait

      As soon as I finish this hamburger, I'm going to kick your ass for saying that.

      Mmm, Big Mac(tm).

  64. It's quite simple why he is guilty by Illserve · · Score: 3, Interesting

    He came here and spoke about his program, hence he trafficked his information here, which is illegal under the DMCA.

    Dmitry violated our law on our soil and has been locked up for it. I hate the DMCA as much as any of us, but he is guilty, and proclaiming him as innocent merely makes one look uninformed.

    1. Re:It's quite simple why he is guilty by Zwack · · Score: 4, Insightful

      He came here and spoke about his program, hence he trafficked his information here, which is illegal under the DMCA.

      I don't believe that talking about weaknesses in software is illegal. It certainly isn't trafficking.

      The trafficking in this case is the sale in the US of software that he first wrote. The fact that he was outside the US is allegedly irrelevant as he/Elcomsoft used a US based server/service to sell the software.

      Claiming he is guilty is surely against US judicial protocol as he is "Presumed Innocent until Proven Guilty".

      Proclaiming him one way or the other merely makes one look uninformed.

      Zwack

      --
      -- Under/Overrated is meta-moderation, and therefore is Redundant.
    2. Re:It's quite simple why he is guilty by singularity · · Score: 4, Insightful

      Funy you should mention *he* looks uninformed.

      Pleading not guilty means that he gets his day in court when he (and his representation) can argue that the DMCA is unconstitutional.

      *That* is the way that laws can be struck down.

      --
      - (c) 2018 Hank Zimmerman
    3. Re:It's quite simple why he is guilty by Squirrel+Killer · · Score: 2
      ...proclaiming him as innocent merely makes one look uninformed.
      No, it makes one look like they understand that under our legal system, he is innocent until proven guilty. Saying that he's unquestionably guilty, especially when one has only read mainstream news reports, makes one look like an ignorant moron.

      -sk

    4. Re:It's quite simple why he is guilty by Illserve · · Score: 2

      I misspoke, shouldn't have used the word guilty. The intent of my message was to demonstrate what laws he was correctly charged with violating here in the US, and not just in Russia, as the parent message implied.

      No he is not guilty(yet). Yes I look uninformed.

    5. Re:It's quite simple why he is guilty by Sarcasmooo! · · Score: 2

      I wonder if trade laws come into play at all. I know a little about trade restrictions, but I don't even know if laws exist that would require US borders to allow trade; as in software from Russia that is about as illegal as a paper clip (having legal and illegal uses).

      It might be interesting to note that I can buy a wife from Russia, but not a piece of software.

    6. Re:It's quite simple why he is guilty by knightbg · · Score: 1

      Ok, so clearly it's better for Slyarov if he's found not guilty. But in the grand scheme, I really wonder which is better. If he's found not guilty, might that not go to show that the DMCA works as it should, as he was found not guilty because he did nothing wrong? Whereas if he's found guilty, we can yell and scream about the injustice inherent in the DMCA.

    7. Re:It's quite simple why he is guilty by supruzr · · Score: 1

      Claiming he is guilty is surely against US judicial protocol as he is "Presumed Innocent until Proven Guilty".

      Raise your hand if you are representing Sklyarov, or are a juror in the case, or are the judge in this case. I thought not. US judicial protocol applies to the judicial system only. It's not a code to live by. His innocence is a nonissue here. He was indicted under a very unjust law, but he DID violate it.

      Proclaiming him one way or the other merely makes one look uninformed.

      One who blinds themself to the importance of this case is not only uninformed, but effectively reinforcing the position of the DMCA. It was a law passed with ignorance, that relies on ignorance to stand.

      Sklyarov DID violate the DMCA. It doesn't need to be said 65 thousand times to be believed. I'm not even the first person in this thread who understands that. This case is not an opportunity to acquit an innocent man. This case is an opportunity to challenge the constitutionality of the law he was arrested under. If you can't see that, don't pretend your transparent support of Sklyarov's innocence is helping in any way.

  65. Perfect opportunity for the Russian govt.. by Da+VinMan · · Score: 1

    Now they can stop the brain drain with some simple FUD.

    Comrade: "Oh, you want to leave the country to work in the US? Well, I have a gift for you."

    Programmer: "What's the Vaseline for?"

    Comrade: "It will make your stay in prison easier to bear."

    That would probably be the end of that.

    --
    Please mod this post only if you think others should/n't read this. I have enough ego^H^H^Hkarma. Thanks!
  66. Actually... by Anonymous Coward · · Score: 0

    ...it's äìèòðè.

  67. Professional Repsonsibilies and DMCA Awareness by guygee · · Score: 5, Insightful
    The sixth principle of the IEEE/ACM Software Engineering Code of Ethics and Professional Practice states:

    6 PROFESSION - Software engineers shall advance the integrity and reputation of the profession consistent with the public interest.

    One implication of this principle is that we all need to stay informed on events related to the intergrity and reputation of our profession in order to defend ourselves against unjustified external attacks. Clearly, the Sklyarov case represents an attack of unprecedented ferocity on the profession of software engineering. Iam currently teaching 2 sections of a graduate-level software engineering course, and in an informal poll last week Iwas shocked to learn that less than five out of sixty students had heard of the DMCA or Dmitri Sklyarov. I emphasized that it is our professional duty to keep informed and to speak out against the persecution of software engineers. Besides linking to information on this and related cases on my course webpages, Iam considering some type of assignment that will encourage students to respond in some way to the threat represented by the DMCA. Letter writing campaign? Protest actions? I am writing slashdot to solicit recommendations.

    1. Re:Professional Repsonsibilies and DMCA Awareness by wowbagger · · Score: 2

      While I am of the personal belief that any sane individual opposes the DMCA and the trial of Dmitri, I also am opposed to a teacher telling his students they must protest an action. What if some student in your class feels that the DMCA is a good thing, and that Dmitri should "... be torn into little bisty pieces and buried alive!"?

      Offer writing letters to the CongressDrone either for or against as an option, or allow them to present a short speech about their thoughts on the case.

  68. A butterfly flaps it's wings in Russia... by Stealth+Dave · · Score: 1

    For the sake of argument, let's postulate that there is a town in New Jersey, let's call it "Podunk" (a purely ficticious town; if there really is a Podunk, NJ, then make up another name), where crossing the street against the light is not against the law. If I jay-walk in Podunk, NJ and then go to visit New York, should I be arrested in New York for jay-walking in Podunk?

    That's essentially what's happening here. Dimitri jay-walked in Russia and now they're trying to prosecute him here. Yes, it's more complicated than that, but at the same time it's really not once you start looking past the legal smoke-screen. Adobe picked what they thought would be an easy target to show that the DMCA means business, and in my opinion have gotten off pretty easy with their "Oops, you're right, Dimitri shouldn't have been arrested," statement. Regardless of whether or not the DMCA is Constitutional, the fact is that the act being prosecuted was performed well outside the jurisdiction of the United States, and we have no business prosecuting this case at all. But then again, that's the whole problem here: business. But that water's been tread a thousand times over here on /.

    Okay, I've spent enough time feeding the trolls. Say goodnight, Gracy.

    - Stealth Dave

    --
    Evil is as eval("does");
    1. Re:A butterfly flaps it's wings in Russia... by FatalException · · Score: 1

      No, but if it was illegal in NY to tell people how to Jaywalk and you still did...

      THAT is what is happening here.

      JAIL DEMITRY WHAT HE DID WAS ILLEGAL.

      (Granted it is insane that telling someone how to jaywalk could be illegal.)

    2. Re:A butterfly flaps it's wings in Russia... by gilroy · · Score: 2
      Blockquoth the poster:

      WHAT HE DID WAS ILLEGAL.

      What he did was legal, because the DMCA is unconstitutional. Of course it'll take a trial to establish this, but his claim is perfectly valid.
    3. Re:A butterfly flaps it's wings in Russia... by dlb · · Score: 1

      No, what you meant to say is "What he did should be legal if the DMCA is ruled to be unconstitutional"

      The DMCA isn't unconstitutional just because someone posted a webpage quoting slashdot. Like you said, it'll take a trial to establish this.

      So, for the time being, the DMCA is constitutional, therefore what he did is still illegal.

    4. Re:A butterfly flaps it's wings in Russia... by AsylumWraith · · Score: 1

      First Amendment buddy. According to the constitution, I can say whatever the hell I want. With the exception of slander, but I'm not entirely sure how that works, and it doesn't apply here anyway.

      He developed the software outside the United States, and the 1st Amendment covers him speaking about it.

      He's not guilty, the DMCA is stupid. What's the problem?

    5. Re:A butterfly flaps it's wings in Russia... by rking · · Score: 1

      No, what you meant to say is "What he did should be legal if the DMCA is ruled to be unconstitutional"

      The DMCA isn't unconstitutional just because someone posted a webpage quoting slashdot. Like you said, it'll take a trial to establish this.

      So, for the time being, the DMCA is constitutional, therefore what he did is still illegal.


      NO. The DMCA either is constitutional or it is not. As yet the courts have not determined whether it is or not. What they determine is whether it has ever been constitutional. It's not a case of it being constitutional until they decide otherwise. If the courts find that it is unconstitutional what they will be saying is that it has never been a valid law. If the courts find that it is constitutional then they will be saying that it has always been a valid law.

      The DMCA is not "constitutional for the time being", it either is constitutional or is not. We can differ in opinions as to which it is and ultimately the courts will determine which of us is right.

    6. Re:A butterfly flaps it's wings in Russia... by cpt+kangarooski · · Score: 2

      There's actually more to it than that. Slander, as you correctly point out, as well as it's brother libel are not protected under the aegis of the First Amendment.

      Additionally, if your speech can be considered a form of conduct, it too may be unprotected. E.g., you can say "The US government ought to be overthrown," and that's speech. But something more specific such as, "Let's start by killing that guy over there, right now," is a little too close for comfort, particularly if people follow through with it. So we don't really want people who arrange a murder, incite a riot, etc. to be able to get off for not having in fact performed any action when they so clearly brought that action about intentionally and specifically. The courts aren't really stupid, you know.

      Additionally, copyrights are directly opposed to the First Amendment. This is skirted around by claiming that 1) the First Amendment did not amend Congress' power to establish copyright if they choose to do so; 2) that as a function of copyright, people have consented through the government to a small infringement of their free speech in return for the benefits of having the material produced (for which the copyright is assured to go away after a time anyway) but that this is generally pretty narrow. In short, the courts have not found there to be, for their purposes, an actual tension.

      Lastly there are issues revolving around self-accepted limitations. E.g., if you reveal a trade secret you were given in confidence, if you breech a contract requiring you not to say something, etc. the First Amendment doesn't work so well.

      So you can see where this is going... the government can claim that his speech induced action, and is therefore unprotected, and that the action was to induce copyright infringements and those are also (generally) unprotected.

      Hopefully the courts will put the smackdown on the prosecution, and the law.

      --
      -- This and all my posts are in the public domain. I am a lawyer. I am not your lawyer, and this is not legal advice.
    7. Re:A butterfly flaps it's wings in Russia... by dachshund · · Score: 2
      Er, if you wrote a book on how to Jaywalk... And somebody else published it in New York. Are you responsible or are they?

      Ignore the hideous first amendment violations.

    8. Re:A butterfly flaps it's wings in Russia... by Anonymous Coward · · Score: 0

      You are a fucking asshole. I read your posts. I looked through the library of shit you post here.

      Fuck off you little shit, get cancer, die.

      About Skylarov, if he was a citizen and eligible to be prosecuted, which he isn't, he would be protected by fair use:
      (read the following you quippy little fuck and realize you are on the communist side here)

      For those of you with "The Law is the Law" attitude, I believe this law undermines our fundamental laws here which are regarded as inalienable. Thomas Jefferson and others should clear this up.

      Intro:

      I feel the need with all the horrible rights violations going recently to highlight Thomas Jefferson's views on copyright. In the writing to ensue, there will be much opinion and conjecture surrounded by a more valued and respected sets of opinions by none other than Thomas Jefferson. Without a doubt, Thomas Jefferson has already covered most of what gets rehashed, particularly when it comes to fair use and the DMCA.

      I feel it is important to this case, especially from the American prospective, to point out that one of the most ingenious, prolific and outspoken forefathers of the USA, where the DMCA and other vile laws live, believe firmly that the bill of rights should have included and explicit reference to freedom from burdensome and unfair copyrights and legislation thereof.

      Thomas Jefferson was concerned about you and me. The people that read periodicals. He was concerned with everyone as a singular entity. You yourself may not know what's best for you if you belong to something bigger. Our [United States] laws are supposed to protect the little people.

      While I'm not suggesting an armed standoff against federal agents necessary in this case, something must be done. We are railroading an expatriate to whom our laws do not bind. Furthermore, our own forefathers, particularly Jefferson, BELIEVE me he is YOUR friend (not the big monopolies like Energy/Petroleum Companies, Microsoft, etc.)

      I'm going to excerpt his beliefs below. Realize that even 200 years ago, the pitfalls of burdensome copyright and the legislation that ensues would erode our freedoms.

      ...

      Thomas Jefferson (1743-1826), in his correspondence with James Madison (1751-1836) was initially hostile to the provision for copyright and patent law in the United States Constitution. On Dec. 20, 1787, Jefferson wrote to Madison from France concerning the recently-drafted Constitution:

      "I do not like... the omission of a bill of rights providing clearly and without the aid of sophisms for freedom of religion, freedom of the press, protection against standing armies, restriction against monopolies, the eternal and unremitting force of the habeas corpus laws, and trials by jury in all matters of fact triable by the laws of the land..."

      Note, here IMHO, Thomas Jefferson wants to, along with our other inalienable rights, establish a freedom from Monopoly. These rights, not excluding freedom from monopoly, were to him as core as the rest of our bill of rights. He repeated this view in his letter to Madison dated July 31, 1788:

      "I sincerely rejoice at the acceptance of our new constitution by nine states. It is a good canvas, on which some strokes only want re-touching. What these are, I think are sufficiently manifested by the general voice from North to South, which calls for a bill of rights. It seems pretty generally understood that this should go to juries, habeas corpus, standing armies, printing, religion and monopolies. I conceive there may be difficulty in finding general modification of these suited to the habits of all the states. But if such cannot be found then it is better to establish trials by jury, the right of Habeas corpus, freedom of the press and freedom of religion in all cases, and to abolish standing armies in time of peace, and monopolies, in all cases, than not to do it in any... The saying there shall be no monopolies lessens the incitements to ingenuity, which is spurred on by the hope of a monopoly for a limited time, as of 14 years; but the benefit even of limited monopolies is too doubtful to be opposed to that of their general suppression."

      Madison, in a letter dated October 17, 1788, responded,

      "With regard to monopolies they are justly classed among the greatest nuisances in government. But is it clear that as encouragements to literary works and ingenious discoveries, they are not too valuable to be wholly renounced? Would it not suffice to reserve in all cases a right to the public to abolish the privilege at a price to be specified in the grant of it? Is there not also infinitely less danger of this abuse in our governments than in most others? Monopolies are sacrifices of the many to the few. Where the power is in the few it is natural for them to sacrifice the many to their own partialities and corruptions. Where the power, as with us, is in the many not in the few, the danger can not be very great that the few will be thus favored. It is much more to be dreaded that the few will be unnecessarily sacrificed to the many.

      I hold the recent copyright extension as an example of what Madison thought there was little danger of. There it was said, even by Madison, the proponent of the said directives, that there would likely be no "a sacrifice of the many to the "partialities and corruptions" of a powerful few."

      I firmly believe the DMCA is both a corruption and a partiality. Anyone with Macrovision stock will try and convince you otherwise.

      Jefferson probably saw that there is some purpose in having intellectual property be protected in some fashion or more likely, IMHO, probably decided that he would rather be a part of creating the ground rules for this countries operations and decided to cut bait at this point. He subsequently said to Madison in a letter on August 28, 1789:

      "I like the declaration of rights as far as it goes, but I should have been for going further. For instance, the following alterations and additions would have pleased me... Article 9. Monopolies may be allowed to persons for their own productions in literature, and their own inventions in the arts, for a term not exceeding ___ years, but for no longer term, and for no other purpose."

      The blank was to be filled in at some future date, obviously. The law is written with the sense that this right would be the right of the people to protect themselves against intellectual fraudulence by companies, e.g., the theft of the 'little man's' ideas. In addition to which, there is always the stance that the people of the fledgling USA would be safeguarded in the Bill of Rights against unduly long copyrights.

      Jefferson's preference for the term of copyright was submitted to Madison a few days afterward, in a letter of September 6, 1789. The proposed term was that of 19 years, based on actuarial calculations:

      "The question Whether one generation of men has a right to bind another seems never to have been started on this [i.e., the European side -- Jefferson was writing from France] or our [American] side of the water... that no such obligation can be so transmitted I think very capable of proof. -- I set out on this ground, which I suppose to be self evident, that the earth belongs in usufruct to the living; that the dead have neither powers nor rights over it... A generation coming in and going out entire... would have a right on the first year of their self-dominion to contract a debt for 33 years, in the 10th for 24, in the 20th for 14, in the 30th for 4, whereas generations, changing daily by daily deaths and births, have one constant term, beginning at the date of their contract, and ending when a majority of those of full age at that date shall be dead. The length of that term may be estimated from the tables of mortality. Take, for instance, the tables of M. de Buffon... [according to which] half of those of 21 years [of age] and upwards living at any one instant of time will be dead in 18 years 8 months, or say 19 years as the nearest integral number. Then 19 years is the term beyond which neither the representatives of a nation, nor even the whole nation itself assembled, can validly extend a debt... This principle that the earth belongs to the living, and not to the dead, is of very extensive application... Turn this subject in your mind, my dear Sir... Your station in the councils of our country gives you an opportunity for producing it to public consideration... Establish the principle... in the new law to be passed for protecting copyrights and new inventions, by securing the exclusive right for 19 instead of 14 years."

      A Jeffersonian computation using life tables from 1992 gives a Jeffersonian copyright term of 30-35 years. (Vital Statistics of the United States 1992, Volume II--Mortality, Part A, Public Health Service, Hyattsville, 1996, Section 6, Table 6-1.) Note, however, that at least one edition of Jefferson's works has a much abridged version of this letter, in which the 19-year computation and the proposal for the term of copyright do not occur.

      One of Jefferson's most famous statements on patent law was in his often-quoted letter of August 13, 1813 to Isaac McPherson, in which he wrote that, since there is no natural right to property in land, how much less is there a natural right to a property in ideas. I think Jefferson's words apply equally well to copyrights as to patents; to "expression" as well as to "ideas": "he who lights his taper at mine, receives light without darkening me."

      A random set of impressions of these laws with which I agree:
      "The scary thing about the DMCA is that it affects everyone, but only a subset of the country realizes it exists, of which a subset understands what it means, of which a subset understands why its so wrong. " quote, kstumpf (ken@stumpf.com).

      "Is there a "voice" amongst this subset that has any power to inflict any change here? Kind of spooky. It makes you wonder where things are headed." quote, kstumpf (ken@stumpf.com).

      As someone pointed out in a discussion, be sure to realize that copyright is referred to at this point as monopoly in Jefferson's letters.

      Its fairly clear that Jefferson uses Monopoly in reference to copyright, which is what it is, you can monopolize on your intellectual property for a set period of time. He was willing to give IP of the day 19 years, but he was very much verbal about fair use, and that public fair use was of the utmost importance.

      Even cursory inspection of Jefferson's views shows his distrust of allowing monopolies run rampant.

      Even Madison has said:
      "With regard to monopolies they are justly classed among the greatest nuisances in government."

      They both realized that in order for Monopolies of any sort to be protected by the government, that undue amounts of arbitration would be necessary.

      Jefferson also affords a Monopoly to the Individual, not a corporate entity:
      "Monopolies may be allowed to persons for their own productions in literature, and their own inventions in the arts, for a term not exceeding ___ years, but for no longer term, and for no other purpose."

      Surely he isn't suggesting that one person could create a monopoly on, lets say, corn. He was referring to copyright. He certainly isn't suggesting that corn could only be sold by one person for 19 years.

      Another thing, imagine if the copyrights were in fact awarded to the people who invented them, not the companies who subsidized them. It would be interesting to see a world where companies like DuPont and Merck (and every other chemical and drug exploitation companies, because that's what they are, the money is in the treatments, not the cure) are made to treat their patent holding scientists with the utmost respect and regard, even more so than the greedy shareholders, because if they left for another company, so leaves their patents!

      The most important of all the Jefferson arguments is this: If IP is so unique, so wonderful and so great, why does it need protection? I don't believe I had quoted this particular argument above, I will work to find it, but the statement is true. If something is obvious, then it really isn't IP. Would you like Bob Metcalfe, the Linux is a piece of crap Windows 2000 rules moron who founded 3COM to hold the patent on 'ethernet'?
      Link: http://iwsun4.infoworld.com/articles/op/xml/99/06/ 21/990621opmetcalfe.xml

      Don't you think its nice that other companies compete with 3COM for the ethernet space, such as Intel, CISCO, et al? Doesn't the standard referred to as "ethernet" get better and better because these companies compete for your business in the same segment?

      "He who receives an idea from me, receives instruction himself without lessening mine; as he who lights his taper at mine, receives light without darkening me. That ideas should freely spread from one to another over the globe, for the moral and mutual instruction of man, and improvement of his condition, seems to have been peculiarly and benevolently designed by nature, when she made them, like fire, expansible over all space, without lessening their density at any point, and like the air in which we breathe, move, and have our physical being, incapable of confinement or exclusive appropriation."
      Thomas Jefferson, in Writings of Thomas Jefferson, vol. 6, H.A. Washington, Ed.,1854, pp. 180-181. Link: http://www.lib.virginia.edu/copyright/

      The message in this passage is clear: an idea is not matter but energy; it cannot be owned, and it isn't diminished by being shared. In any discussion of copyright, it is useful to begin by reminding ourselves that ideas can't be copyrighted and can't be owned--only expression can. Furthermore, even when expression is copyrighted, academics ought to bear in mind their right to Fair Use, a crucial exception to copyright that exists in order to enable teaching, research, and news reporting.

      A few more quotes to muse upon:

      "It will be of little avail to the people that the laws are made by men of their choice, if the laws are so voluminous that they cannot be read, or so incoherent that they cannot be understood; if they... undergo such incessant changes that no man who knows what the law is today can guess what it will be tomorrow "
      -- James Madison

      And finally:
      "The people are the only censors of their governors: and even their errors will tend to keep these to the true principles of their institution. To punish these errors too severely would be to suppress the only safeguard of the public liberty. The way to prevent these irregular interpositions of the people is to give them full information of their affairs thro' the channel of the public papers, & to contrive that those papers should penetrate the whole mass of the people. The basis of our governments being the opinion of the people, the very first object should be to keep that right; and were it left to me to decide whether we should have a government without newspapers or newspapers without a government, I should not hesitate a moment to prefer the latter. But I should mean that every man should receive those papers & be capable of reading them. I am convinced that those societies (as the Indians) which live without government enjoy in their general mass an infinitely greater degree of happiness than those who live under the European governments. Among the former, public opinion is in the place of law, & restrains morals as powerfully as laws ever did anywhere. Among the latter, under pretence of governing they have divided their nations into two classes, wolves & sheep. I do not exaggerate. This is a true picture of Europe. Cherish therefore the spirit of our people, and keep alive their attention. Do not be too severe upon their errors, but reclaim them by enlightening them. If once they become inattentive to the public affairs, you & I, & Congress & Assemblies, judges & governors shall all become wolves. "
      Thomas Jefferson To Edward Carrington
      Paris, Jan. 16, 1787

  69. What? by Anonymous Coward · · Score: 0

    Umm, so you think it would be fair if you wrote some kind of article against the Chinese government and then they arrested you when you decided to travel there?

    yeah...

  70. Hey! by Anonymous Coward · · Score: -1, Offtopic
    Fuck you, I'm supposed to be learning how to use Tcl for work. And while I'm on that subject... For something different!

    183848 random... 77145

    5662 random... 223559

    146916 random... 194053

    48890 random... 112467

    77344 random... 223601

    70998 random... 219295

    145052 random... 119709

    17266 random... 143723

    122520 random... 35017

    83534 random... 176631

    136468 random... 61684

    145962 random... 185539

    175376 random... 127713

    46150 random... 55247

    219084 random... 48781

    31777 random... 50715

    57352 random... 202169

    186366 random... 169063

    197060 random... 23397

    14554 random... 113651

    125568 random... 157585

    49142 random... 123519

    228796 random... 100733

    114450 random... 92107

    132344 random... 195561

    77998 random... 7895

    230772 random... 50389

    57866 random... 84003

    106480 random... 146177

    85734 random... 110191

    136748 random... 99885

    158722 random... 126779

    223656 random... 115993

    213470 random... 87687

    79204 random... 27461

    22458 random... 145555

    132512 random... 125169

    178966 random... 159263

    26460 random... 43357

    204914 random... 56811

    69208 random... 133385

    80142 random... 120439

    41876 random... 193653

    60970 random... 27587

    27984 random... 221281

    187718 random... 146895

    232012 random... 103693

    118370 random... 160347

    77704 random... 72761

    54078 random... 77095

    7172 random... 37989

    199066 random... 18803

    209280 random... 74257

    204854 random... 198591

    33148 random... 195965

    103122 random... 172939

    89336 random... 20073

    124270 random... 215447

    46644 random... 217621

    204938 random... 46755

    83632 random... 155009

    117606 random... 52783

    162860 random... 123117

    222274 random... 92411

    160488 random... 222745

    40862 random... 93639

    151396 random... 105413

    19770 random... 105427

    149984 random... 36081

    182038 random... 38495

    6492 random... 11869

    101426 random... 28203

    158680 random... 202697

    198414 random... 19831

    206228 random... 147765

    159082 random... 209219

    206736 random... 207073

    75590 random... 5967

    27724 random... 135821

    109218 random... 184795

    20552 random... 147129

    75646 random... 60263

    216900 random... 30757

    118874 random... 182451

    147328 random... 60304

    140982 random... 55999

    215036 random... 189693

    87250 random... 213707

    192504 random... 105001

    153518 random... 13335

    206452 random... 131669

    215946 random... 22243

    12080 random... 197697

    116134 random... 125231

    55788 random... 118765

    101762 random... 120699

    127336 random... 38873

    23070 random... 5767

    33764 random... 93381

    84538 random... 183635

    195552 random... 227569

    119126 random... 193503

    65500 random... 170717

    184434 random... 162091

    202328 random... 32264

    147982 random... 77879

    67476 random... 120372

    127850 random... 153987

    176464 random... 216161

    155718 random... 180175

    206732 random... 169869

    228706 random... 196763

    60360 random... 185977

    50174 random... 157671

    149188 random... 97445

    92442 random... 215539

    202496 random... 195153

    15670 random... 229247

    96444 random... 113341

    41618 random... 126794

    139192 random... 203369

    150126 random... 190423

    111860 random... 30357

    130954 random... 97571

    97968 random... 57985

    24422 random... 216879

    68716 random... 222893

    17730 random... 27067

    90344 random... 64280

    30238 random... 190535

    220452 random... 175429

    154106 random... 116883

    93280 random... 78257

    84054 random... 114271

    60188 random... 219165

    102322 random... 197099

    152856 random... 154633

    119630 random... 215607

    135124 random... 158261

    38058 random... 140995

    176912 random... 183969

    36166 random... 39503

    50700 random... 151117

    76514 random... 202011

    116488 random... 151865

    35262 random... 29479

    129475 random... 114213

    220570 random... 106547

    69504 random... 87121

    180278 random... 231615

    143676 random... 151933

    201170 random... 225867

    151864 random... 25961

    67758 random... 177175

    64052 random... 233109

    42570 random... 116707

    89264 random... 50241

    80998 random... 150575

    167532 random... 187309

    75266 random... 25083

    66280 random... 193817

    186654 random... 48391

    136868 random... 49605

    230842 random... 1619

    177696 random... 10993

    118550 random... 201567

    185884 random... 118301

    218418 random... 152875

    98072 random... 92169

    9166 random... 155063

    153300 random... 85237

    153194 random... 32451

    11728 random... 189665

    60101 random... 119119

    128396 random... 100173

    38050 random... 66587

    16584 random... 99001

    101438 random... 139815

    165892 random... 96869

    100506 random... 102643

    150080 random... 229137

    6454 random... 124991

    156348 random... 207805

    118801 random... 212619

    104056 random... 228713

    28590 random... 25687

    85364 random... 168021

    69898 random... 19235

    28272 random... 100609

    127526 random... 173103

    215020 random... 40877

    233154 random... 227835

    27112 random... 42329

    207966 random... 216583

    114980 random... 122757

    139834 random... 109331

    69408 random... 127345

    122581 random... 145119

    43036 random... 18653

    213810 random... 217387

    128024 random... 139401

    47758 random... 81335

    19092 random... 97909

    209066 random... 183363

    231760 random... 92641

    200198 random... 49935

    34252 random... 199949

    66786 random... 1243

    179720 random... 173817

    90814 random... 3431

    1668 random... 166885

    1562 random... 114099

    93376 random... 38033

    141750 random... 200767

    210044 random... 181821

    119698 random... 148235

    98232 random... 180649

    183086 random... 221463

    14260 random... 178517

    182154 random... 184291

    231728 random... 28289

    25446 random... 176623

    62060 random... 134637

    60994 random... 17531

    42408 random... 9625

    225182 random... 79239

    119716 random... 82373

    109050 random... 21907

    152864 random... 229041

    46678 random... 67295

    69852 random... 57949

    156146 random... 195243

    152920 random... 50057

    2574 random... 195511

    79508 random... 55605

    49642 random... 108419

    218256 random... 45793

    710 random... 121167

    47884 random... 86861

    94818 random... 153115

    230792 random... 3129

    225406 random... 63143

    176580 random... 128677

    147674 random... 12531

    193408 random... 115025

    74742 random... 50239

    62396 random... 227133

    29650 random... 86987

    100344 random... 228841

    52718 random... 24855

    45172 random... 56789

    97866 random... 42403

    196400 random... 183297

    84454 random... 102191

    145068 random... 35245

    104642 random... 80379

    225256 random... 67673

    86430 random... 51847

    88484 random... 27141

    78778 random... 30995

    232992 random... 120753

    163030 random... 71327

    13404 random... 148381

    56498 random... 190635

    217432 random... 80009

    49806 random... 823

    5780 random... 154677

    62314 random... 164291

    135888 random... 32545

    186182 random... 90639

    8716 random... 168653

    116130 random... 88027

    208904 random... 76281

    134398 random... 170855

    68292 random... 11749

    151706 random... 189363

    50560 random... 15377

    70134 random... 114751

    92348 random... 41085

    68242 random... 13259

    199416 random... 8233

    108590 random... 175767

    31924 random... 8981

    67338 random... 3235

    44912 random... 204609

    19366 random... 80303

    218220 random... 177517

    212354 random... 205371

    108328 random... 71705

    29981 random... 142279

    222116 random... 22533

    143290 random... 60947

    46944 random... 208561

    151958 random... 200415

    202012 random... 125789

    113586 random... 220843

    79640 random... 116937

    128974 random... 110711

    74388 random... 23605

    82922 random... 83139

    1936 random... 93473

    7110 random... 161167

    6284 random... 176781

    131938 random... 151835

    222792 random... 11449

    160766 random... 9063

    130180 random... 130277

    99354 random... 118771

    157568 random... 124305

    74422 random... 106559

    181116 random... 94333

    74450 random... 133707

    42424 random... 158441

    79278 random... 15894

    222452 random... 115029

    111946 random... 130403

    104880 random... 194497

    212774 random... 146031

    127468 random... 100205

    102402 random... 8058

    123176 random... 71193

    166750 random... 145607

    149604 random... 901

    31418 random... 201555

    74272 random... 111089

    90966 random... 17503

    15260 random... 148317

    161074 random... 74411

    4248 random... 135625

    152462 random... 222519

    38356 random... 113333

    200490 random... 199747

    54224 random... 35361

    17158 random... 72335

    57612 random... 54349

    31586 random... 131163

    175240 random... 29177

    119934 random... 10471

    162308 random... 121125

    123802 random... 61619

    231936 random... 96657

    228214 random... 52991

    231228 random... 43389

    35986 random... 231563

    126584 random... 42921

    115438 random... 183575

    104052 random... 191509

    181706 random... 216483

    118000 random... 218177

    10854 random... 225391

    156908 random... 50925

    144322 random... 95099

    200616 random... 205273

    129950 random... 90567

    38884 random... 125380

    51258 random... 208915

    178592 random... 179889

    112726 random... 153503

    107100 random... 80797

    147314 random... 163371

    210328 random... 23945

    212622 random... 131959

    113876 random... 118772

    176170 random... 47747

    212304 random... 206881

    156038 random... 123855

    88012 random... 69389

    183906 random... 150043

    118279 random... 23097

    23614 random... 166631

    205188 random... 39205

    78362 random... 127539

    60736 random... 183953

    120630 random... 185407

    114044 random... 48381

    43858 random... 199115

    7992 random... 199849

    69806 random... 96663

    50740 random... 56597

    178314 random... 160291

    23408 random... 116865

    159142 random... 67439

    9516 random... 144493

    52610 random... 186747

    213544 random... 76121

    45918 random... 230215

    1892 random... 150789

    58426 random... 160403

    132000 random... 28657

    182294 random... 86751

    4828 random... 164765

    112242 random... 84139

    205016 random... 72393

    130510 random... 166967

    64404 random... 7861

    147818 random... 185475

    46672 random... 11489

    66246 random... 110863

    88460 random... 37197

    64354 random... 9371

    195528 random... 4345

    104702 random... 171879

    28036 random... 5093

    63450 random... 232627

    225088 random... 138065

    218742 random... 133759

    59516 random... 34173

    165010 random... 58187

    36984 random... 182761

    231278 random... 41879

    221556 random... 179413

    117770 random... 178467

    183664 random... 232001

    1382 random... 72879

    218476 random... 225773

    210690 random... 124986

    119144 random... 127640

    76318 random... 11975

    154212 random... 169669

    1466 random... 154323

    35680 random... 184817

    225174 random... 4831

    192668 random... 230685

    174322 random... 122219

    34776 random... 174793

    70670 random... 201207

    103444 random... 135221

    127338 random... 57475

    179792 random... 143649

    134086 random... 68303

    114060 random... 197197

    131234 random... 135771

    110728 random... 232505

    23486 random... 142503

    206020 random... 79397

    189594 random... 99571

    37568 random... 15825

    37942 random... 228479

    184956 random... 118332

    49490 random... 94347

    204664 random... 64361

    74478 random... 160855

    137012 random... 222549

    84106 random... 131363

    169200 random... 71617

    144614 random... 11631

    220588 random... 40685

    80322 random... 161659

    150056 random... 5913

    225310 random... 103367

    118883 random... 42181

    231098 random... 659

    113376 random... 133873

    186710 random... 102687

    92764 random... 177821

    7218 random... 232555

    21976 random... 94793

    153870 random... 21367

    29204 random... 137781

    143338 random... 40835

    75792 random... 18529

    226886 random... 65102

    210700 random... 217997

    202914 random... 117211

    111368 random... 119865

    68542 random... 4199

    146436 random... 161893

    226970 random... 146547

    27904 random... 177041

    217398 random... 230335

    184892 random... 222909

    166546 random... 114443

    27000 random... 167017

    62894 random... 193431

    95668 random... 127445

    119562 random... 49699

    172016 random... 135873

    126310 random... 60527

    106284 random... 189421

    123458 random... 127995

    102952 random... 224729

    64926 random... 197383

    228260 random... 14277

    103354 random... 231251

    24032 random... 88689

    67606 random... 163103

    50460 random... 18397

    165554 random... 219051

    208408 random... 128585

    225102 random... 34999

    149396 random... 165813

    61930 random... 91907

    138384 random... 153121

    53318 random... 6735

    172492 random... 130829

    101346 random... 217243

    188360 random... 52857

    151294 random... 89831

    191748 random... 71845

    165722 random... 148659

    76096 random... 46673

    20790 random... 27967

    63164 random... 138621

    24658 random... 79115

    132792 random... 163369

    191726 random... 100503

    74740 random... 31637

    138954 random... 89251

    162608 random... 112065

    70822 random... 215279

    117036 random... 116652

    53570 random... 17787

    90664 random... 7961

    144798 random... 90055

    175652 random... 128709

    212026 random... 187283

    66720 random... 87217

    140054 random... 56031

    46108 random... 131165

    193842 random... 185899

    24536 random... 110793

    137230 random... 150647

    137364 random... 230581

    140138 random... 137475

    96592 random... 90209

    208326 random... 65743

    98060 random... 213837

    1954 random... 27611

    17928 random... 2425

    209342 random... 184359

    164356 random... 40613

    110490 random... 118387

    85184 random... 126801

    194998 random... 206975

    97212 random... 24829

    36626 random... 118923

    171640 random... 137897

    55854 random... 32791

    141428 random... 5205

    172042 random... 144419

    64175 random... 220033

    10790 random... 96687

    40684 random... 71021

    199938 random... 197755

    189032 random... 4569

    88606 random... 228743

    74340 random... 43717

    54074 random... 39891

    160288 random... 228785

    231702 random... 19743

    87580 random... 17117

    157554 random... 227371

    143768 random... 74505

    178702 random... 36599

    101076 random... 38773

    26090 random... 101187

    138064 random... 209441

    172038 random... 107215

    217292 random... 177549

    43426 random... 146843

    214920 random... 43897

    95294 random... 148071

    205828 random... 159845

    74202 random... 159859

    204416 random... 90513

    3190 random... 92927

    60924 random... 66301

    155858 random... 82635

    213112 random... 23849

    19566 random... 74263

    27380 random... 202197

    213514 random... 30371

    27888 random... 28225

    130021 random... 60399

    82156 random... 190253

    163650 random... 5947

    74984 random... 201561

    130078 random... 114695

    38052 random... 85189

    173306 random... 3603

    201760 random... 114737

    195414 random... 110431

    36188 random... 10845

    141682 random... 34859

    13656 random... 159433

    207950 random... 67767

    27604 random... 186101

    37098 random... 76675

    66512 random... 18849

    170566 random... 179663

    110220 random... 173197

    156194 random... 175131

    181768 random... 93305

    77502 random... 60199

    88196 random... 147813

    138970 random... 4787

    16704 random... 48721

    173558 random... 14655

    119932 random... 225149

    5586 random... 216523

    23480 random... 86697

    202414 random... 132311

    121907 random... 174805

    182282 random... 208419

    230896 random... 221377

    147494 random... 204591

    85228 random... 69485

    143682 random... 207739

    204776 random... 172953

    219550 random... 184007

    156324 random... 217861

    104378 random... 190995

    66592 random... 63089

    140886 random... 96223

    157340 random... 103197

    170674 random... 17771

    175128 random... 153865

    208142 random... 220599

    142996 random... 125813

    103530 random... 1987

    101264 random... 154401

    61318 random... 231695

    187916 random... 122253

    117730 random... 39707

    81864 random... 40441

    143678 random... 170535

    124612 random... 130468

    18906 random... 883

    97280 random... 190737

    233014 random... 92095

    20732 random... 188349

    183826 random... 105803

    147960 random... 106537

    209774 random... 3351

    190708 random... 196565

    85002 random... 66979

    163376 random... 23553

    65830 random... 207407

    149484 random... 51181

    192578 random... 93435

    120232 random... 216089

    185886 random... 136903

    141860 random... 57477

    198394 random... 67091

    38688 random... 168625

    88982 random... 226719

    144796 random... 71453

    18930 random... 224107

    111704 random... 212361

    37198 random... 73655

    204372 random... 147829

    54506 random... 92163

    186640 random... 151457

    206214 random... 17551

    228428 random... 177165

    204322 random... 149339

    102216 random... 144313

    11390 random... 78567

    168004 random... 145061

    203418 random... 139315

    180992 random... 107409

    155446 random... 216383

    121020 random... 80317

    115154 random... 108171

    11128 random... 207785

    166062 random... 45079

    124916 random... 158613

    46090 random... 197027

    183024 random... 111361

    54758 random... 103215

    104812 random... 28589

    16386 random... 123643

    215720 random... 19737

    31774 random... 13511

    210468 random... 159685

    219002 random... 219219

    138016 random... 229553

    143190 random... 63967

    142364 random... 79581

    34738 random... 54635

    125592 random... 147529

    63566 random... 145143

    32980 random... 33077

    2154 random... 21571

    60368 random... 27105

    210502 random... 9359

    83916 random... 230413

    210530 random... 36507

    178504 random... 61241

    215358 random... 151975

    125252 random... 17829

    14745 random... 33203

    7680 random... 97297

    115574 random... 48831

    30268 random... 3005

    5202 random... 144139

    25976 random... 207273

    69550 random... 48407

    52404 random... 136981

    167498 random... 104355

    210352 random... 13889

    227046 random... 153583

    151340 random... 51117

    63874 random... 210491

    140328 random... 38425

    55262 random... 125319

    174436 random... 16133

    103290 random... 102547

    190304 random... 171441

    153238 random... 208415

    193692 random... 190429

    167666 random... 33963

    78040 random... 165257

    22734 random... 146551

    65108 random... 23925

    26602 random... 197699

    134736 random... 48673

    193670 random... 219087

    76684 random... 150221

    140898 random... 207835

    164552 random... 230649

    72766 random... 100583

    118980 random... 1957

    55514 random... 136371

    92608 random... 126545

    146742 random... 208639

    177596 random... 14013

    213970 random... 72587

    68664 random... 205801

    141998 random... 174615

    48052 random... 16469

    195786 random... 71203

    26480 random... 229377

    139174 random... 35951

    139308 random... 115885

    142082 random... 22779

    98536 random... 208793

    210270 random... 184327

    100004 random... 99141

    3897 random... 146195

    19872 random... 121009

    211286 random... 69663

    166300 random... 159197

    112434 random... 3691

    87128 random... 12105

    196942 random... 92279

    99156 random... 143413

    38570 random... 4227

    173584 random... 23201

    57798 random... 151375

    143372 random... 123789

    173986 random... 29723

    66120 random... 105337

    12734 random... 215271

    42628 random... 189605

    201882 random... 83059

    190976 random... 123153

    90550 random... 114047

    76284 random... 162301

    56018 random... 158475

    162232 random... 114089

    366 random... 187543

    152180 random... 165717

    102154 random... 34211

    51888 random... 3265

    90662 random... 222639

    221356 random... 185453

    75330 random... 153787

    182504 random... 173721

    131038 random... 179015

    148452 random... 17029

    38906 random... 96723

    142240 random... 92657

    115734 random... 137311

    204188 random... 69405

    99442 random... 4139

    54936 random... 125832

    56270 random... 169527

    80404 random... 224501

    43818 random... 60355

    139472 random... 8289

    162886 random... 131663

    160140 random... 18637

    64993 random... 130011

    191368 random... 36665

    15102 random... 78439

    143876 random... 145893

    10330 random... 17267

    153024 random... 84241

    220598 random... 133695

    164092 random... 151229

    185106 random... 113803

    139640 random... 171177

    30574 random... 49751

    189108 random... 11605

    212042 random... 102819

    154096 random... 23873

    9510 random... 88687

    49004 random... 6381

    145858 random... 151355

    190632 random... 189529

    194846 random... 192903

    83620 random... 43397

    110394 random... 158611

    27488 random... 40305

    45142 random... 11039

    79836 random... 73693

    91250 random... 92907

    108184 random... 132041

    176718 random... 12535

    230612 random... 195189

    117225 random... 17603

    12240 random... 52897

    56774 random... 191631

    150028 random... 212045

    130722 random... 39259

    114056 random... 159993

    51070 random... 93287

    143364 random... 49381

    13658 random... 178035

    131392 random... 205649

    127926 random... 161023

    66620 random... 90237

    2194 random... 160331

    162168 random... 218665

    117422 random... 207639

    207796 random... 35093

    90570 random... 66787

    10544 random... 141441

    126118 random... 140975

    224172 random... 16429

    57026 random... 202683

    68200 random... 89177

    174174 random... 145351

    101348 random... 2565

    111802 random... 190739

    18336 random... 64753

    221270 random... 85407

    101404 random... 56861

    67698 random... 85675

    27992 random... 62408

    114766 random... 231863

    117524 random... 223221

    35818 random... 68675

    74832 random... 187489

    116486 random... 133263

    111820 random... 124877

    29154 random... 139291

    191048 random... 92985

    133822 random... 178919

    188676 random... 192613

    185690 random... 180147

    179584 random... 75281

    164598 random... 191935

    178172 random... 5949

    93586 random... 125003

    34680 random... 215017

    12974 random... 114711

    186868 random... 172565

    109962 random... 106339

    1136 random... 117633

    70630 random... 62447

    1644 random... 176941

    220418 random... 92475

    55912 random... 105689

    20766 random... 38023

    48740 random... 116997

    220474 random... 146771

    11808 random... 625

    30421 random... 35679

    175516 random... 30172

    52530 random... 142507

    9944 random... 159561

    232078 random... 17719

    158036 random... 44853

    122410 random... 178307

    95184 random... 58081

    217478 random... 41295

    155212 random... 139469

    213666 random... 44443

    41480 random... 9657

    56254 random... 20711

    226308 random... 54565

    174362 random... 27699

    136576 random... 133073

    210870 random... 166207

    227324 random... 173181

    7378 random... 87755

    11832 random... 223849

    44846 random... 57303

    212980 random... 195797

    173514 random... 71971

    171248 random... 224385

    131302 random... 68399

    73836 random... 21613

    217730 random... 52347

    73384 random... 16601

    23838 random... 150535

    28772 random... 85509

    116986 random... 118163

    101280 random... 69937

    148694 random... 168351

    106588 random... 217565

    150642 random... 90859

    188696 random... 145353

    119949 random... 159287

    16404 random... 57781

    226538 random... 94275

    1552 random... 21089

    9606 random... 48463

    106700 random... 92877

    62434 random... 114011

    208008 random... 140665

    140222 random... 218919

    147076 random... 49253

    222810 random... 178867

    171584 random... 83601

    99958 random... 137855

    131772 random... 7548

    45266 random... 231243

    182904 random... 161641

    215918 random... 228375

    150772 random... 133589

    111306 random... 9763

    109040 random... 162177

    69094 random... 6191

    11628 random... 192685

    155522 random... 223419

    11176 random... 187673

    194910 random... 88327

    199844 random... 23301

    54778 random... 55955

    39072 random... 7729

    86486 random... 106143

    44380 random... 155357

    88434 random... 28651

    126487 random... 83145

    57742 random... 97079

    187476 random... 228853

    164330 random... 32067

    172624 random... 192161

    180678 random... 219535

    44492 random... 30669

    226 random... 51803

    145800 random... 78457

    78014 random... 156711

    84868 random... 220325

    160602 random... 116659

    109376 random... 21393

    37750 random... 75647

    69564 random... 178621

    216338 random... 169035

    169912 random... 162089

    183726 random... 108823

    10100 random... 210837

    92554 random... 90851

    114288 random... 218305

    34982 random... 224559

    116715 random... 172973

    172290 random... 118267

    135464 random... 54681

    86878 random... 19655

    202212 random... 119749

    156026 random... 12243

    80800 random... 175217

    48534 random... 67231

    174428 random... 175005

    176242 random... 17579

    22296 random... 38473

    35150 random... 154167

    217684 random... 91061

    201258 random... 111235

    49232 random... 27489

    49606 random... 6863

    196620 random... 129997

    61154 random... 106011

    216328 random... 76025

    86142 random... 172519

    148676 random... 933

    95770 random... 143027

    180864 random... 83281

    156278 random... 23295

    232252 random... 3133

    29329 random... 143307

    219064 random... 96041

    97518 random... 71575

    220532 random... 219669

    124426 random... 33443

    140400 random... 8257

    98534 random... 190191

    53548 random... 46445

    232962 random... 75003

    145000 random... 102617

    141534 random... 57991

    80228 random... 220485

    15802 random... 57299

    175776 random... 115633

    131029 random... 104607

    221404 random... 165341

    104178 random... 197035

    Ok, so they're not random, but pseudo-random. Sue me. Or lick me. Whichever works for you.

  71. How do you pronounce Sklyarov? by scotpurl · · Score: 2

    This is not a troll. I'm quite serious.

    How does one pronounce Dmitri Sklyarov's last name?

    There used to be the controversy of Linus' first name (and of Linux), and Linus thankfully provided us all with a .au or .wav file of it.

    Spasibo.

    1. Re:How do you pronounce Sklyarov? by SuiteSisterMary · · Score: 2

      sk'el-yar-ov Ooops but that's too lame, so let me throw in some random text. ;alkhflakhdfklahdlkhdgio49087q435oil,wg Is that better, slashcode?

      --
      Vintage computer games and RPG books available. Email me if you're interested.
    2. Re:How do you pronounce Sklyarov? by aboyko · · Score: 1

      Like it's spelled.

      skl (like in diSCLaimer)
      ya (like in YAhoo!)
      rov (like in... umm... ROV)

      Now run those three together fairly quickly; roll the R a little bit; maybe swallow the "V" a little; and you're set.

  72. Russian Government by Anonymous Coward · · Score: -1, Offtopic

    The Russian government makes me want to

    +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+
    * \ |\ \ *
    j | / \ \ j
    a | | \ \ a
    c | | \ \ __ c
    k / \ \ \/__|__,,..---v--. k
    o | |__,,\.--"""\/ | \ o
    f | | \ _> f
    f| | _ _ _ _ | / f
    *| | /_v_v_v_\..---""'`-' *
    j| | __,,.| | | | | j
    a| / \ \_h_h_h_/ a
    c | | | c
    k | | | k
    o \ |\ | o
    f \ | \___/ f
    f \ | f
    * \ | *
    j | | j
    a | | a
    c | | c
    k | | k
    o | | o
    f | | f
    f | | f
    * | | *
    +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+


    try to keep posts on topic.
    Try to reply to other people comments instead of starting new threads.
    Read other people's messages before posting your own to avoid simply duplicating what has already been said.
    Use a clear subject that describes what your message is about.
    Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page)
    Problems regarding accounts or comment posting should be sent to CowboyNeal.

    Linux - Das System fuer schlaue Maedchen ;) -- banshee
    All trademarks and copyrights on this page are owned by their respective owners

  73. live nude goats! (was: goats, the musical) by Anonymous Coward · · Score: 0

    Let's not forget that google has thousands of pictures of naked goats for you!

  74. No question of jurisdiction by DiningPhilosopher · · Score: 2


    A company selling a product in America is subject to American laws prohibiting the sale of that product. Very simple really.

    --
    /* The beatings will continue until morale improves. */
    1. Re:No question of jurisdiction by Ami+Ganguli · · Score: 2

      So is that the legal question? Whether or not selling something on your web site constitutes selling something in the U.S.?

      --
      It is tempting, if the only tool you have is a hammer, to treat everything as if it were a nail. - Abraham Maslow
    2. Re:No question of jurisdiction by DiningPhilosopher · · Score: 2


      Actually, the transactions took place entirely within the US. Customers paid a company in the US and downloaded the application from a file server in the US. Unless I've been misinfomed.

      --
      /* The beatings will continue until morale improves. */
    3. Re:No question of jurisdiction by rking · · Score: 1

      And yet strangely neither this US company nor its officers or employees are being prosecuted.

      None of this explains the basis on which Dmitri Sklyarov is being accused of a crime.

    4. Re:No question of jurisdiction by DiningPhilosopher · · Score: 2


      If I sell you an illegal product, Visa is not liable for handling your money, and UPS is not liable for delivering the goods. I don't really see a difference here.

      --
      /* The beatings will continue until morale improves. */
  75. Threat? by Da+VinMan · · Score: 1

    First, they have to figure out *why* it's a threat. Part of being an effective and moral software professional is the ability to be rational. Why is the DMCA a threat? Is there anything good about it too? Etc. I hear more demonizing about the DMCA and any kind of IP law than I know what to do with, and much more of it than I care to consider comes down to "because I don't like it". I'm sure thieves don't like car-theft prevention devices either, but the larger good of society guarantees that they're here to say despite that.

    Even if your students still don't know about the DMCA when your class is finished, it won't matter. It's much more important for them to have a handle on being able to separate the issues on their own.

    --
    Please mod this post only if you think others should/n't read this. I have enough ego^H^H^Hkarma. Thanks!
    1. Re:Threat? by kreyg · · Score: 2

      Why is the DMCA a threat?

      Because it goes beyond mandating what I may do, it mandates what I may know, and limits what I may legitimately and peacefully tell others in words, pictures, symbols, or their digital (electical, magnetic, optical) equivalents.

      That is why.

      --
      sig fault
    2. Re:Threat? by metachimp · · Score: 1
      And provides that you may be incarcerated for a significant portion of your life.


      Regardless of whether you think he's guilty or not, don't the DMCA's punishments seem a little harsh? He made a piece of software, nobody died, nobody got hooked on drugs. My main problem is that the penalties are so harsh.


      Haven't these guys ever heard the phrase "Let the punishment fit the crime?"

      --
      The system has failed you, don't fail yourself. --Billy Bragg
    3. Re:Threat? by kreyg · · Score: 2

      I would say that the requirement to immediately remove material immediately upon the accusation of infringement somewhat defeats the intention of "innocent until proven guilty" as well. It's more like "punished even if eventually found innocent."

      *sigh*

      --
      sig fault
  76. Pictures from the August 30 San Fransico Protest by mr_don't · · Score: 1

    I put up some photos from the August 30 march on the Federal Building to demand Dmitry's charges be dropped. I hope to soon put a clip up with RMS and Bruce Perens speaking to the crowd...

  77. Arrest the Dutch by Anonymous Coward · · Score: 0

    Here is an interesting parallel. What if we arrest all of the people who smoked pot while in Amsterdam when they visit or Americans returning to the US from Amsterdam. This is the same as what is happening here. Pot is "legal" in Amsterdam however illegal here in the US. Just like what Dmitri did in Russia is legal but illegal here.

    my $0.02

    1. Re:Arrest the Dutch by Anonymous Coward · · Score: 0

      No, he, in conjunction with Elcom, imported the software. Its like trying to bring back some kind nugs, and complaining that you once set foot in Amsterdam so you now have a pot pass for the globe. He wasn't indicted for creating a program that reads e-books he was indicted for marketing & distributing said program in the US, which is undeniable. If Elcom would have stuck to 100% Russian clients they wouldn't have had this problem.

  78. Remember when by Perldivr · · Score: 1

    Remember when the Russians were the bad guys because they lived in a tolitarian society where the government could arrest you at any time if you did or said something they didn't like.

    Hmmm. It seems that we have become what we feared the most about them.

    - Perldivr

    1. Re:Remember when by Qrlx · · Score: 1

      But there is an important difference. In Red Russia, the Government would throw you in jail if you poase a threat the Govenrment. In America, the Government throws you in jajil if you pose a threat to a Corporation. Our New U.S. Flag makes it easier to understand.

      That guy with the sig, the quote by the president of Visa, has got it right.

    2. Re:Remember when by Moridineas · · Score: 1

      Yes, except in this case it's for blatantly breaking copyright law.

      Thnik about it this way. You buy a book. A hardcover. A novel we'll say. Should you be able to make a copy for your home, and one for your office, and then one for school...maybe one for the car while you're at it? and hey, if a friend wants a copy, why don't just give him one, i mean you have 8 already... I don't think that is right. Do you?

      Scott

    3. Re:Remember when by metachimp · · Score: 1
      They cheated! There are two Microsoft logos on that flag.


      I get the point, and I agree, but it seemed funny to me that they had the Playboy and Apple Computer logos, since when did Playboy become on par with the likes of G.E. and Shell Oil?

      --
      The system has failed you, don't fail yourself. --Billy Bragg
  79. It's pronounced like this by Anonymous Coward · · Score: -1, Offtopic
    This is only a rough approximation; it is a hard sound for most American English speakers to reproduce exactly:


    * g o a t s e x * g o a t s e x * g o a t s e x *
    g g
    o / \ \ / \ o
    a| | \ | | a
    t| `. | | : t
    s` | | \| | s
    e \ | / / \\\ -- \\ : e
    x \ \/ --~~ ~--| \ | x
    * \ \-~ ~-\ | *
    g \ \ .--------.__\| | g
    o \ \_// ((> \ | o
    a \ . C ) _ ((> | / a
    t /\ | C )/ \ (> |/ t
    s / /\| C) | (> / \ s
    e | ( C__)\__/ // / / \ e
    x | \ | \\__// (/ | x
    * | \ \) `---- --' | *
    g | \ \ / / | g
    o | / | | \ | o
    a | | / \ \ | a
    t | / / | | \ |t
    s | / / \/\/ | |s
    e | / / | | | |e
    x | | | | | |x
    * g o a t s e x * g o a t s e x * g o a t s e x *

  80. .. by Anonymous Coward · · Score: -1, Offtopic


    5i'm 1cool, i 6beat 5the 0filter! oor4

    5i'm 1cool, i 5beat 0the 7filter! zvx3

    5i'm 7cool, i 7beat 1the 1filter! vud3

    6i'm 7cool, i 8beat 1the 2filter! cqw5

    1i'm 0cool, i 2beat 4the 0filter! cgk9

    1i'm 5cool, i 2beat 8the 2filter! jqw1

    4i'm 4cool, i 3beat 7the 2filter! sah6

    5i'm 3cool, i 4beat 5the 8filter! mxo7

    3i'm 7cool, i 6beat 6the 3filter! wal6

    6i'm 3cool, i 7beat 8the 6filter! rfb7

    5i'm 4cool, i 4beat 2the 5filter! vus7

    0i'm 5cool, i 8beat 5the 0filter! uls8

    0i'm 8cool, i 6beat 8the 8filter! bed6

    8i'm 8cool, i 0beat 8the 9filter! pge1

    8i'm 2cool, i 0beat 8the 5filter! phg4

    1i'm 2cool, i 8beat 8the 7filter! aby5

    0i'm 2cool, i 8beat 8the 5filter! tcg2

    4i'm 4cool, i 8beat 1the 8filter! ygu2

    6i'm 6cool, i 2beat 5the 5filter! mrw0

    1i'm 7cool, i 8beat 5the 9filter! hlw6

    6i'm 4cool, i 2beat 7the 6filter! lnn2

    5i'm 5cool, i 1beat 4the 5filter! ixi9

    7i'm 4cool, i 9beat 7the 6filter! zim8

    5i'm 6cool, i 3beat 1the 8filter! fdx7

    9i'm 0cool, i 5beat 5the 5filter! uvj8

    5i'm 7cool, i 3beat 3the 8filter! zti3

    1i'm 9cool, i 9beat 6the 4filter! lid8

    1i'm 0cool, i 4beat 5the 4filter! nyc1

    6i'm 5cool, i 3beat 5the 2filter! qwh7

    6i'm 9cool, i 1beat 4the 2filter! wyr4

    5i'm 5cool, i 5beat 8the 5filter! bsh7

    3i'm 8cool, i 8beat 4the 9filter! tpe3

    1i'm 8cool, i 4beat 9the 0filter! yom7

    3i'm 5cool, i 1beat 5the 8filter! ymj9

    5i'm 7cool, i 9beat 3the 1filter! nkd4

    3i'm 6cool, i 9beat 3the 4filter! ocr5

    7i'm 4cool, i 6beat 7the 7filter! qjy3

    1i'm 1cool, i 8beat 6the 1filter! qay6

    0i'm 6cool, i 7beat 2the 4filter! chz5

    3i'm 6cool, i 1beat 7the 5filter! uoz2

    9i'm 5cool, i 1beat 9the 2filter! ask0

    7i'm 6cool, i 3beat 1the 5filter! rvn6

    6i'm 2cool, i 8beat 6the 6filter! fpr7

    8i'm 9cool, i 1beat 2the 5filter! wcf8

    4i'm 1cool, i 4beat 5the 8filter! olu1

    5i'm 2cool, i 5beat 6the 2filter! ywm4

    1i'm 1cool, i 9beat 8the 5filter! oye1

    6i'm 7cool, i 8beat 4the 7filter! usy6

    5i'm 4cool, i 6beat 6the 2filter! rdn5

    0i'm 0cool, i 6beat 8the 5filter! bei1

    4i'm 3cool, i 6beat 1the 5filter! wsn3

    7i'm 5cool, i 5beat 6the 7filter! lcx0

    1i'm 4cool, i 7beat 8the 5filter! txh0

    5i'm 9cool, i 1beat 5the 2filter! wmg9

    7i'm 0cool, i 3beat 8the 1filter! apm3

    8i'm 4cool, i 9beat 1the 3filter! dor3

    8i'm 7cool, i 6beat 5the 9filter! qpy2

    8i'm 4cool, i 5beat 1the 8filter! ozv8

    7i'm 5cool, i 5beat 5the 2filter! pkr1

    8i'm 7cool, i 6beat 6the 3filter! niv1

    4i'm 3cool, i 2beat 8the 2filter! fql8

    1i'm 9cool, i 1beat 4the 6filter! rdc4

    7i'm 4cool, i 1beat 0the 4filter! qko7

    1i'm 8cool, i 6beat 8the 1filter! opt0

    4i'm 2cool, i 0beat 9the 1filter! rga9

    3i'm 3cool, i 2beat 8the 7filter! obp6

    5i'm 6cool, i 4beat 2the 7filter! yhn5

    9i'm 7cool, i 5beat 7the 8filter! evq2

    9i'm 5cool, i 2beat 7the 0filter! dtk4

    3i'm 5cool, i 4beat 2the 1filter! dzz4

    1i'm 7cool, i 3beat 1the 6filter! rrb2

    3i'm 0cool, i 0beat 3the 7filter! cab9

    4i'm 6cool, i 5beat 2the 9filter! fvn3

    3i'm 7cool, i 4beat 7the 1filter! cba9

    2i'm 4cool, i 8beat 6the 2filter! euc6

    4i'm 4cool, i 4beat 8the 4filter! fyb5

    8i'm 4cool, i 9beat 8the 9filter! sqx1

    2i'm 8cool, i 5beat 8the 5filter! xwh1

    7i'm 4cool, i 6beat 8the 3filter! bms4

    1i'm 4cool, i 3beat 2the 3filter! faz1

    6i'm 6cool, i 8beat 6the 2filter! bxg2

    6i'm 0cool, i 9beat 1the 5filter! abm8

    5i'm 9cool, i 8beat 3the 4filter! dod1

    0i'm 2cool, i 1beat 1the 5filter! ssp5

    7i'm 8cool, i 9beat 7the 8filter! pui3

    8i'm 7cool, i 3beat 1the 5filter! ocv6

    6i'm 1cool, i 7beat 5the 5filter! exf6

    7i'm 3cool, i 4beat 3the 8filter! fvq3

    1i'm 2cool, i 4beat 3the 6filter! gqs7

    8i'm 8cool, i 6beat 7the 7filter! vvg6

    1i'm 3cool, i 3beat 6the 5filter! fvn9

    2i'm 8cool, i 9beat 2the 3filter! vhq3

    5i'm 8cool, i 3beat 4the 0filter! vqd2

    2i'm 4cool, i 3beat 8the 4filter! rbf0

    7i'm 3cool, i 8beat 6the 2filter! jzo2

    2i'm 3cool, i 4beat 7the 7filter! coo8

    0i'm 3cool, i 6beat 6the 6filter! qfy5

    2i'm 5cool, i 4beat 1the 4filter! cjq3

    0i'm 7cool, i 7beat 1the 1filter! tnh9

    3i'm 4cool, i 2beat 8the 1filter! dtn8

    8i'm 2cool, i 2beat 5the 9filter! ain9

    1i'm 9cool, i 6beat 6the 5filter! lwm1

    2i'm 1cool, i 8beat 5the 1filter! ord8

    7i'm 3cool, i 2beat 4the 5filter! esi5

    4i'm 1cool, i 2beat 3the 5filter! jyj3

    2i'm 4cool, i 2beat 3the 2filter! ozo2

    3i'm 2cool, i 0beat 5the 3filter! tir1

    7i'm 8cool, i 2beat 5the 2filter! pdm7

    7i'm 6cool, i 7beat 7the 0filter! env2

    4i'm 2cool, i 9beat 3the 2filter! jan4

    7i'm 2cool, i 3beat 7the 8filter! nhn3

    1i'm 4cool, i 7beat 7the 4filter! vtm5

    6i'm 9cool, i 6beat 3the 3filter! abl6

    4i'm 7cool, i 6beat 8the 4filter! cbh7

    4i'm 1cool, i 8beat 6the 8filter! vpf3

    1i'm 7cool, i 5beat 7the 1filter! jcn1

    6i'm 1cool, i 2beat 1the 2filter! kls0

    1i'm 4cool, i 0beat 5the 7filter! xve6

    6i'm 0cool, i 1beat 7the 4filter! pzo4

    3i'm 2cool, i 9beat 5the 8filter! pso4

    4i'm 3cool, i 7beat 0the 3filter! aem7

    6i'm 4cool, i 8beat 7the 5filter! vgb9

    8i'm 6cool, i 4beat 4the 5filter! ldu9

    3i'm 1cool, i 3beat 0the 1filter! ddv1

    2i'm 5cool, i 7beat 7the 5filter! alm5

    2i'm 3cool, i 1beat 2the 4filter! zuj8

    1i'm 5cool, i 8beat 7the 8filter! lmc4

    4i'm 5cool, i 2beat 3the 2filter! qmu9

    8i'm 6cool, i 0beat 2the 4filter! uit6

    7i'm 5cool, i 2beat 1the 6filter! lse1

    2i'm 3cool, i 6beat 2the 4filter! xvg9

    6i'm 6cool, i 5beat 8the 5filter! job6

    2i'm 1cool, i 7beat 8the 2filter! yoy8

    2i'm 8cool, i 5beat 6the 5filter! ukx1

    3i'm 9cool, i 4beat 8the 6filter! jaz7

    3i'm 6cool, i 8beat 8the 8filter! uzw4

    6i'm 6cool, i 4beat 2the 7filter! dyo2

    9i'm 2cool, i 8beat 1the 7filter! zkv8

    2i'm 8cool, i 9beat 0the 7filter! eee7

    2i'm 1cool, i 6beat 4the 2filter! nmc1

    2i'm 3cool, i 7beat 5the 8filter! ikz7

    0i'm 5cool, i 2beat 0the 5filter! zei1

    2i'm 3cool, i 8beat 2the 0filter! pmy1

    7i'm 1cool, i 4beat 3the 6filter! kag1

    6i'm 5cool, i 8beat 1the 4filter! twj8

    0i'm 3cool, i 2beat 0the 8filter! bhc2

    5i'm 8cool, i 8beat 3the 4filter! sks0

    2i'm 9cool, i 0beat 2the 6filter! fev5

    1i'm 3cool, i 7beat 3the 2filter! kuj1

    4i'm 3cool, i 5beat 6the 2filter! trm5

    1i'm 1cool, i 4beat 6the 5filter! oqa9

    3i'm 3cool, i 7beat 1the 1filter! rsy4

    2i'm 4cool, i 6beat 1the 4filter! nde7

    0i'm 6cool, i 7beat 2the 6filter! arv1

    6i'm 8cool, i 7beat 5the 5filter! ueg3

    7i'm 2cool, i 1beat 1the 4filter! eaz3

    2i'm 9cool, i 8beat 5the 1filter! hgc6

    1i'm 5cool, i 1beat 9the 2filter! igi7

    0i'm 1cool, i 0beat 1the 6filter! nof8

    4i'm 4cool, i 8beat 8the 5filter! din2

    0i'm 1cool, i 7beat 3the 1filter! sth0

    6i'm 2cool, i 5beat 0the 1filter! wbe5

    5i'm 4cool, i 3beat 3the 7filter! geu0

    8i'm 7cool, i 3beat 9the 5filter! vpd5

    5i'm 6cool, i 7beat 6the 8filter! siy2

    2i'm 1cool, i 4beat 7the 3filter! ypr2

    3i'm 2cool, i 6beat 7the 2filter! uqj3

    7i'm 4cool, i 2beat 3the 6filter! vtc4

    5i'm 8cool, i 4beat 6the 4filter! wuu6

    4i'm 4cool, i 5beat 1the 0filter! oiu8

    5i'm 6cool, i 3beat 2the 4filter! eru2

    4i'm 7cool, i 8beat 7the 2filter! wrs3

    1i'm 0cool, i 1beat 5the 4filter! ajz6

    7i'm 8cool, i 8beat 5the 5filter! xoi5

    5i'm 4cool, i 6beat 8the 0filter! cwn2

    7i'm 5cool, i 5beat 7the 4filter! bpj8

    7i'm 8cool, i 4beat 7the 5filter! jqd4

    3i'm 1cool, i 9beat 9the 1filter! vhz8

    6i'm 3cool, i 4beat 1the 2filter! jkl6

    2i'm 3cool, i 5beat 5the 4filter! axz6

    5i'm 8cool, i 3beat 5the 5filter! cha5

    7i'm 6cool, i 3beat 2the 5filter! cca3

    4i'm 3cool, i 4beat 1the 4filter! phm6

    2i'm 1cool, i 6beat 4the 5filter! ppw1

    3i'm 1cool, i 6beat 5the 2filter! bvn1

    5i'm 6cool, i 8beat 6the 0filter! woy2

    7i'm 4cool, i 5beat 1the 3filter! euu4

    5i'm 5cool, i 4beat 4the 6filter! fxf0

    1i'm 8cool, i 4beat 1the 1filter! yyh3

    7i'm 5cool, i 8beat 3the 5filter! zjq6

    7i'm 9cool, i 5beat 5the 8filter! whv5

    6i'm 7cool, i 0beat 2the 3filter! muy5

    1i'm 2cool, i 4beat 6the 0filter! kkk0

    2i'm 8cool, i 4beat 0the 5filter! zvh5

    4i'm 1cool, i 6beat 2the 5filter! ttq6

    8i'm 2cool, i 8beat 6the 0filter! nbc1

    8i'm 9cool, i 6beat 5the 0filter! fpt7

    4i'm 1cool, i 3beat 8the 8filter! tvq7

    4i'm 5cool, i 0beat 2the 3filter! grl1

    3i'm 9cool, i 4beat 8the 7filter! oxy3

    3i'm 3cool, i 4beat 7the 1filter! ixt2

    9i'm 8cool, i 7beat 6the 2filter! peg5

    8i'm 4cool, i 6beat 3the 8filter! esz8

    0i'm 5cool, i 4beat 4the 5filter! gci9

    2i'm 8cool, i 4beat 3the 5filter! rit1

    9i'm 5cool, i 0beat 5the 9filter! cof4

    5i'm 6cool, i 1beat 3the 3filter! mcs5

    4i'm 7cool, i 0beat 8the 6filter! lrh9

    4i'm 2cool, i 2beat 2the 3filter! hlb1

    5i'm 4cool, i 5beat 8the 8filter! tgd5

    4i'm 9cool, i 3beat 4the 7filter! ewn2

    1i'm 7cool, i 7beat 8the 4filter! nhu8

    1i'm 1cool, i 1beat 2the 8filter! jhw5

    5i'm 6cool, i 1beat 1the 1filter! hif3

    1i'm 3cool, i 8beat 1the 8filter! cil4

    7i'm 7cool, i 5beat 1the 6filter! apw6

    3i'm 6cool, i 2beat 2the 3filter! xht9

    7i'm 3cool, i 7beat 8the 2filter! ywb5

    0i'm 3cool, i 8beat 5the 4filter! wvv5

    5i'm 2cool, i 5beat 2the 6filter! lnh3

    0i'm 4cool, i 4beat 3the 5filter! upc4

    2i'm 4cool, i 8beat 8the 7filter! ckm3

    1i'm 5cool, i 1beat 7the 6filter! qzz7

    1i'm 1cool, i 1beat 1the 8filter! lpc4

    1i'm 6cool, i 8beat 2the 4filter! qtn8

    6i'm 5cool, i 1beat 3the 2filter! tpt3

    6i'm 8cool, i 4beat 5the 5filter! prc3

    2i'm 8cool, i 1beat 3the 3filter! koy4

    2i'm 1cool, i 1beat 1the 4filter! qqn4

    5i'm 3cool, i 0beat 5the 1filter! waq3

    9i'm 8cool, i 7beat 9the 7filter! ztt0

    3i'm 2cool, i 6beat 5the 0filter! orj4

    1i'm 8cool, i 7beat 2the 6filter! cjy1

    2i'm 8cool, i 4beat 7the 8filter! muh8

    8i'm 7cool, i 2beat 0the 5filter! bia6

    3i'm 7cool, i 5beat 8the 6filter! obu8

    1i'm 3cool, i 5beat 8the 3filter! mhb5

    3i'm 6cool, i 3beat 7the 5filter! asv9

    1i'm 8cool, i 7beat 4the 0filter! ttv2

    4i'm 8cool, i 2beat 2the 5filter! mer6

    4i'm 8cool, i 4beat 2the 6filter! pxk7

    5i'm 3cool, i 6beat 6the 3filter! myg1

    8i'm 7cool, i 5beat 3the 1filter! ijf5

    4i'm 3cool, i 9beat 3the 4filter! xwv3

    4i'm 9cool, i 4beat 2the 2filter! dpk3

    8i'm 5cool, i 8beat 1the 5filter! wak5

    7i'm 7cool, i 9beat 1the 5filter! jhk9

    4i'm 7cool, i 4beat 8the 1filter! eir1

    6i'm 1cool, i 0beat 9the 5filter! ste9

    1i'm 6cool, i 8beat 0the 2filter! eku1

    7i'm 5cool, i 5beat 9the 6filter! txc3

    5i'm 2cool, i 0beat 0the 2filter! sem3

    7i'm 8cool, i 7beat 7the 2filter! njb0

    8i'm 2cool, i 7beat 5the 2filter! qcm2

    5i'm 8cool, i 4beat 3the 0filter! jcc4

    1i'm 2cool, i 1beat 3the 1filter! kwa4

    4i'm 3cool, i 8beat 4the 9filter! itr1

    9i'm 6cool, i 3beat 6the 2filter! kwm5

    6i'm 7cool, i 6beat 3the 1filter! dxs3

    4i'm 0cool, i 4beat 8the 1filter! ngp5

    4i'm 3cool, i 2beat 4the 1filter! jov4

    1i'm 4cool, i 3beat 8the 6filter! swd0

    2i'm 0cool, i 7beat 7the 6filter! vje8

    6i'm 8cool, i 2beat 6the 4filter! udw6

    1i'm 8cool, i 5beat 1the 1filter! lbv3

    9i'm 3cool, i 6beat 3the 7filter! wqm5

    1i'm 5cool, i 5beat 6the 5filter! onf3

    3i'm 0cool, i 4beat 1the 5filter! omr5

    2i'm 8cool, i 8beat 1the 4filter! uzh7

    5i'm 0cool, i 5beat 3the 2filter! xil7

    2i'm 9cool, i 0beat 3the 2filter! erd5

    7i'm 4cool, i 1beat 3the 3filter! hrx2

    1i'm 7cool, i 1beat 6the 5filter! bkt2

    4i'm 1cool, i 5beat 4the 4filter! pjm9

    1i'm 2cool, i 6beat 1the 8filter! oak8

    1i'm 8cool, i 8beat 7the 7filter! dyo6

    1i'm 9cool, i 2beat 9the 4filter! xzc5

    3i'm 6cool, i 4beat 4the 8filter! viy3

    7i'm 7cool, i 9beat 4the 8filter! ayt3

    6i'm 1cool, i 6beat 6the 6filter! juz5

    4i'm 4cool, i 0beat 6the 7filter! viq6

    6i'm 3cool, i 3beat 6the 5filter! olq4

    8i'm 2cool, i 6beat 8the 7filter! swi4

    8i'm 8cool, i 2beat 4the 7filter! cky4

    8i'm 7cool, i 2beat 6the 3filter! gps4

    1i'm 8cool, i 8beat 7the 2filter! fgl0

    4i'm 5cool, i 5beat 4the 8filter! jwi7

    4i'm 8cool, i 1beat 8the 7filter! mgj5

    5i'm 1cool, i 0beat 2the 3filter! jzi8

    2i'm 6cool, i 2beat 4the 2filter! nci6

    3i'm 7cool, i 5beat 8the 4filter! pqa3

    5i'm 8cool, i 6beat 7the 8filter! spj6

    7i'm 4cool, i 2beat 5the 9filter! tsr5

    0i'm 1cool, i 5beat 3the 7filter! guw1

    7i'm 4cool, i 1beat 4the 6filter! nfn2

    2i'm 4cool, i 2beat 2the 5filter! chj8

    0i'm 6cool, i 5beat 8the 5filter! vis5

    1i'm 8cool, i 4beat 7the 7filter! xju9

    7i'm 6cool, i 5beat 3the 6filter! nzz1

    1i'm 7cool, i 2beat 7the 4filter! npd4

    8i'm 1cool, i 1beat 8the 6filter! ily8

    6i'm 4cool, i 3beat 4the 5filter! swz1

    3i'm 5cool, i 5beat 7the 4filter! mjo2

    7i'm 8cool, i 6beat 3the 4filter! xnx1

    4i'm 5cool, i 7beat 5the 4filter! org5

    3i'm 1cool, i 2beat 5the 2filter! zau4

    5i'm 2cool, i 7beat 4the 1filter! gfc9

    5i'm 9cool, i 1beat 5the 6filter! ywg5

    3i'm 3cool, i 6beat 9the 8filter! ihu1

    8i'm 5cool, i 1beat 3the 1filter! qgp6

    6i'm 3cool, i 8beat 9the 1filter! gpt9

    6i'm 8cool, i 1beat 3the 5filter! kmx8

    7i'm 5cool, i 4beat 5the 6filter! hkg7

    2i'm 6cool, i 1beat 8the 7filter! woq4

    9i'm 4cool, i 1beat 5the 3filter! nfu2

    7i'm 4cool, i 2beat 6the 6filter! euo5

    2i'm 6cool, i 6beat 6the 7filter! xbd6

    4i'm 6cool, i 7beat 5the 9filter! ngb7

    4i'm 8cool, i 4beat 0the 1filter! uwy8

    2i'm 1cool, i 1beat 4the 2filter! srf8

    6i'm 3cool, i 6beat 4the 5filter! twr7

    8i'm 0cool, i 6beat 2the 8filter! gut0

    2i'm 4cool, i 3beat 5the 0filter! wnl1

    4i'm 6cool, i 4beat 6the 6filter! txg9

    1i'm 1cool, i 2beat 4the 3filter! iqq8

    4i'm 5cool, i 4beat 0the 5filter! ajp7

    5i'm 6cool, i 0beat 8the 2filter! xed2

    0i'm 5cool, i 4beat 3the 2filter! nob6

    7i'm 1cool, i 7beat 3the 8filter! tvs6

    7i'm 4cool, i 8beat 5the 3filter! nil5

    9i'm 3cool, i 5beat 7the 6filter! vwp5

    4i'm 6cool, i 4beat 1the 2filter! jsn1

    0i'm 0cool, i 5beat 7the 4filter! rjt5

    5i'm 8cool, i 4beat 7the 3filter! ooh4

    4i'm 2cool, i 0beat 9the 8filter! jld2

    1i'm 4cool, i 6beat 0the 0filter! llg2

    7i'm 3cool, i 7beat 0the 1filter! kam6

    6i'm 5cool, i 3beat 1the 2filter! zgh8

    2i'm 7cool, i 1beat 1the 3filter! ofa1

    5i'm 6cool, i 8beat 3the 2filter! zrk5

    8i'm 8cool, i 4beat 8the 2filter! ius0

    2i'm 3cool, i 0beat 4the 9filter! mac8

    3i'm 7cool, i 5beat 6the 9filter! gvw5

    2i'm 7cool, i 9beat 8the 8filter! nyy3

    7i'm 9cool, i 2beat 1the 1filter! oit2

    8i'm 6cool, i 7beat 9the 9filter! tps4

    6i'm 4cool, i 4beat 7the 8filter! qwj8

    7i'm 6cool, i 1beat 1the 6filter! ygh1

    2i'm 4cool, i 1beat 3the 2filter! zzw1

    3i'm 7cool, i 3beat 2the 0filter! xqv4

    7i'm 3cool, i 6beat 2the 6filter! yfw2

    3i'm 3cool, i 2beat 8the 4filter! hku8

    1i'm 5cool, i 3beat 1the 4filter! jar3

    6i'm 2cool, i 6beat 4the 9filter! jse0

    1i'm 9cool, i 3beat 7the 3filter! bwk4

    0i'm 8cool, i 5beat 9the 8filter! zyr2

    6i'm 2cool, i 3beat 5the 8filter! mac5

    2i'm 6cool, i 6beat 7the 6filter! jfm4

    6i'm 8cool, i 6beat 4the 3filter! gze2

    7i'm 5cool, i 2beat 4the 6filter! bdv1

    9i'm 5cool, i 3beat 3the 3filter! mbx5

    3i'm 1cool, i 5beat 8the 7filter! bhb7

    2i'm 3cool, i 7beat 7the 1filter! dqn6

    6i'm 3cool, i 3beat 8the 3filter! dnj7

    2i'm 3cool, i 2beat 7the 1filter! oed4

    6i'm 7cool, i 8beat 4the 2filter! buc2

    1i'm 8cool, i 6beat 3the 4filter! mzh2

    9i'm 3cool, i 8beat 9the 8filter! brg0

    6i'm 8cool, i 3beat 3the 9filter! pxx5

    5i'm 6cool, i 4beat 7the 6filter! hqd6

    5i'm 5cool, i 7beat 8the 7filter! omc8

    9i'm 3cool, i 1beat 9the 6filter! jwg1

    1i'm 1cool, i 6beat 1the 8filter! rtz6

    1i'm 4cool, i 5beat 9the 5filter! dqq7

    5i'm 8cool, i 7beat 0the 5filter! fbm6

    6i'm 4cool, i 4beat 9the 3filter! cvv5

    4i'm 9cool, i 4beat 3the 7filter! thd8

    6i'm 2cool, i 4beat 8the 9filter! rnk5

    2i'm 0cool, i 3beat 7the 2filter! dov5

    3i'm 7cool, i 7beat 2the 1filter! tgi5

    2i'm 8cool, i 8beat 2the 6filter! eez6

    9i'm 3cool, i 2beat 7the 3filter! ked7

    5i'm 3cool, i 0beat 4the 2filter! uiy6

    7i'm 6cool, i 5beat 0the 9filter! fyg1

    0i'm 7cool, i 5beat 6the 1filter! vhi2

    7i'm 3cool, i 3beat 5the 2filter! aje1

    0i'm 3cool, i 1beat 5the 6filter! faj4

    7i'm 1cool, i 3beat 0the 7filter! dsd9

    7i'm 8cool, i 8beat 5the 3filter! jvt1

    0i'm 8cool, i 5beat 2the 2filter! uck3

    3i'm 1cool, i 2beat 5the 8filter! frm5

    2i'm 1cool, i 5beat 3the 7filter! brn7

    2i'm 3cool, i 4beat 0the 2filter! irs4

    6i'm 6cool, i 9beat 2the 3filter! tpv4

    1i'm 7cool, i 6beat 7the 8filter! onu2

    4i'm 6cool, i 3beat 2the 3filter! pke1

    7i'm 3cool, i 6beat 4the 3filter! jxc7

    7i'm 3cool, i 6beat 6the 3filter! omr0

    8i'm 4cool, i 1beat 2the 4filter! vsi2

    2i'm 8cool, i 4beat 1the 2filter! iql2

    5i'm 6cool, i 7beat 3the 1filter! dzx7

    4i'm 1cool, i 6beat 6the 8filter! lhv7

    3i'm 4cool, i 5beat 9the 4filter! slu0

    5i'm 7cool, i 1beat 5the 0filter! xrw2

    1i'm 2cool, i 6beat 6the 2filter! nti5

    7i'm 8cool, i 0beat 6the 1filter! jfo5

    2i'm 2cool, i 4beat 4the 0filter! wlb0

    6i'm 9cool, i 5beat 8the 2filter! hrk7

    7i'm 1cool, i 2beat 6the 2filter! lwj7

    2i'm 1cool, i 6beat 8the 6filter! fty8

    9i'm 2cool, i 7beat 2the 4filter! ycy1

    8i'm 4cool, i 5beat 1the 8filter! rbq2

    3i'm 4cool, i 8beat 7the 5filter! xsq1

    2i'm 5cool, i 0beat 5the 5filter! azr5

    5i'm 3cool, i 5beat 7the 4filter! mri4

    5i'm 4cool, i 7beat 1the 2filter! alg0

    6i'm 8cool, i 5beat 6the 2filter! cvk4

    8i'm 8cool, i 1beat 8the 2filter! pzf7

    8i'm 5cool, i 4beat 1the 4filter! kcv8

    2i'm 7cool, i 3beat 7the 3filter! hro5

    2i'm 2cool, i 2beat 3the 9filter! xgk5

    4i'm 1cool, i 9beat 5the 4filter! zzk6

    1i'm 0cool, i 7beat 1the 1filter! iuj7

    9i'm 2cool, i 5beat 3the 7filter! gtp2

    9i'm 2cool, i 4beat 1the 6filter! aif4

    3i'm 2cool, i 1beat 1the 7filter! kfl0

    7i'm 2cool, i 2beat 5the 7filter! jhd7

    4i'm 3cool, i 5beat 3the 9filter! pav1

    2i'm 7cool, i 2beat 5the 4filter! fwx4

    7i'm 1cool, i 8beat 0the 4filter! jpf2

    5i'm 0cool, i 4beat 5the 7filter! rlr5

    7i'm 8cool, i 3beat 4the 8filter! ixk7

    6i'm 8cool, i 4beat 0the 2filter! krn2

    0i'm 5cool, i 2beat 3the 8filter! xtx9

    5i'm 6cool, i 4beat 4the 0filter! nyy3

    1i'm 5cool, i 7beat 7the 6filter! jbn5

    5i'm 3cool, i 8beat 7the 6filter! bqj7

    2i'm 3cool, i 1beat 7the 0filter! klj9

    8i'm 3cool, i 7beat 5the 3filter! iob5

    3i'm 8cool, i 4beat 9the 2filter! fzm1

    2i'm 9cool, i 6beat 7the 5filter! faf2

    9i'm 5cool, i 7beat 4the 9filter! utv3

    2i'm 2cool, i 8beat 1the 5filter! flx9

    2i'm 0cool, i 2beat 6the 5filter! aud5

    5i'm 2cool, i 6beat 9the 5filter! xwt7

    6i'm 0cool, i 9beat 6the 6filter! bda7

    3i'm 8cool, i 1beat 9the 2filter! bkq3

    0i'm 2cool, i 9beat 3the 1filter! coy2

    1i'm 5cool, i 0beat 8the 5filter! hgz4

    3i'm 3cool, i 1beat 1the 1filter! mhs3

    7i'm 7cool, i 8beat 1the 5filter! uic4

    0i'm 2cool, i 1beat 4the 0filter! byu1

    7i'm 2cool, i 6beat 6the 3filter! qsy9

    9i'm 5cool, i 3beat 7the 5filter! kfi1

    8i'm 9cool, i 1beat 2the 7filter! iru3

    1i'm 8cool, i 2beat 6the 4filter! kfd7

    2i'm 5cool, i 7beat 9the 5filter! qgh2

    5i'm 8cool, i 4beat 2the 5filter! mjg3

    0i'm 2cool, i 6beat 3the 0filter! tny9

    0i'm 4cool, i 6beat 6the 1filter! jci3

    9i'm 8cool, i 2beat 3the 8filter! yxv1

    6i'm 0cool, i 9beat 8the 6filter! vpj4

    0i'm 3cool, i 7beat 5the 4filter! gbg6

    6i'm 5cool, i 8beat 5the 3filter! hla8

    2i'm 8cool, i 7beat 8the 4filter! qxy6

    4i'm 0cool, i 1beat 8the 3filter! asq8

    8i'm 8cool, i 6beat 9the 3filter! ypa6

    7i'm 5cool, i 3beat 3the 5filter! jgn8

    3i'm 1cool, i 3beat 7the 2filter! hia0

    7i'm 7cool, i 8beat 8the 9filter! lvi6

    8i'm 3cool, i 8beat 5the 0filter! vxm7

    3i'm 6cool, i 4beat 3the 0filter! jfj0

    7i'm 8cool, i 5beat 7the 4filter! znj0

    2i'm 8cool, i 8beat 8the 4filter! pox4

    7i'm 0cool, i 2beat 7the 2filter! ele5

    8i'm 6cool, i 8beat 7the 5filter! qhn6

    1i'm 4cool, i 7beat 8the 0filter! xys6

    7i'm 6cool, i 5beat 3the 3filter! xmz4

    6i'm 8cool, i 8beat 0the 3filter! byr3

    8i'm 2cool, i 7beat 6the 2filter! rsj2

    4i'm 8cool, i 4beat 2the 2filter! fmh3

    4i'm 4cool, i 7beat 2the 2filter! bro5

    5i'm 5cool, i 7beat 7the 5filter! iox1

    4i'm 2cool, i 8beat 8the 0filter! bds6

    5i'm 6cool, i 3beat 4the 6filter! yov6

    7i'm 7cool, i 3beat 3the 2filter! ylj6

    2i'm 6cool, i 7beat 2the 6filter! hrk7

    1i'm 6cool, i 3beat 2the 2filter! rqh8

    5i'm 8cool, i 5beat 7the 6filter! pyt0

    2i'm 2cool, i 4beat 8the 8filter! rcv2

    5i'm 4cool, i 5beat 3the 5filter! oav3

    3i'm 6cool, i 5beat 4the 3filter! lmn0

    6i'm 4cool, i 8beat 7the 0filter! uka5

    9i'm 9cool, i 6beat 2the 0filter! tfd2

    6i'm 5cool, i 5beat 4the 0filter! fbv8

    1i'm 6cool, i 8beat 0the 1filter! jgj3

    8i'm 1cool, i 8beat 0the 7filter! cwt5

    2i'm 5cool, i 2beat 5the 7filter! pad6

    7i'm 8cool, i 1beat 3the 5filter! lnw7

    6i'm 3cool, i 8beat 6the 8filter! ksz5

    1. Re:.. by mrnobo1024 · · Score: -1, Offtopic

      All this spamming makes me want to

      +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+
      * \ |\ \ *
      j | / \ \ j
      a | | \ \ a
      c | | \ \ __ c
      k / \ \ \/__|__,,..---v--. k
      o | |__,,\.--"""\/ | \ o
      f | | \ _> f
      f| | _ _ _ _ | / f
      *| | /_v_v_v_\..---""'`-' *
      j| | __,,.| | | | | j
      a| / \ \_h_h_h_/ a
      c | | | c
      k | | | k
      o \ |\ | o
      f \ | \___/ f
      f \ | f
      * \ | *
      j | | j
      a | | a
      c | | c
      k | | k
      o | | o
      f | | f
      f | | f
      * | | *
      +* j a c k * o f f * j a c k * o f f * j a c k * o f f *+
      Please try to keep posts on topic.
      Try to reply to other people comments instead of starting new threads.
      Read other people's messages before posting your own to avoid simply duplicating what has already been said.
      Use a clear subject that describes what your message is about.
      Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page)
      Problems regarding accounts or comment posting should be sent to CowboyNeal.

  81. The Cyber Archipelago by Bluesee · · Score: 5, Informative

    That story about Derek was funny, and it reminded me of the book I am currently reading, The Gulag Archipelago, by Solzhynetsin (sp!). That non-fictional story is an account of how power can corrupt, basically. The problem in Stalinist Russia was that the Reds were, if I have this right, basically trying to create a new society the ideology of which was vulnerable to the thoughts of objective people who could see the shortcomings of it. In their effort to control thought, the officials found it necessary to root out all possible instances of anti-communist behavior; unfortunately this included such things as not reaching the party farm production objectives (ten years in prison for not growing enough grain!) and not surrendering to German armies in WWII (when the POWs were returned to the SU in '45 - by Churchill, incidentally, against the soldiers' wills - rather than being welcomed back as heroes, they were arrested, tortured, and given 10-yr sentences, since they must have been spies to have survived the German camps!). Basically, Stalin, in his paranoia, and by extension the entire nation, found it necessary to control behavior by draconian means.

    My point (and I do have one) is that the enforcement of infinitesimally minute behaviors requires the rooting out and punishing of the majority of the citizens of a nation: the mother country goes to war on its citizens. The way to do this is to put each and every citizen at risk of loss of liberty; i.e., each citizen is breaking some law or another. In this manner, the State gains control over the behavior of its population, and in a greater degree than just copying ebooks. Once you have copied an ebook, or, taken to the logical extreme, say, exceeded 55 mph (or snuck a beer into a college football game), you are a criminal.

    But, while speeding doesn't leave a record of itself, ebook copying does and so leaves a legacy, a record of the crime. It can be likened to arresting you for a failed drug test; you are not doing a crime now, but there is proof that you once did.

    For these reasons, the framers of the Constitution would wisely refrain from endorsing the bastardization of their concept of protection of Science and Arts through copyright. The prosecution of the law requires that we become Stalinist in the degree to which we must root out the crime. Napster points this out effectively, in my opinion: the only way to catch all those crimes is to monitor each and every terminal 24/7. And that gives away too much power to the government for freedom to be guaranteed, even in a Democracy.

    If you didn't follow that, feel free to email me with any questions you might have...

    --
    SDMI: Finally! Music that won't rip or burn! Brought to you by the fine folks at RIAA.
    1. Re:The Cyber Archipelago by sdo1 · · Score: 5, Interesting
      But, while speeding doesn't leave a record of itself, ebook copying does and so leaves a legacy, a record of the crime

      The way things are headed, I can GUARANTEE you that things like speeding WILL INDEED be monitored. It starts slowly, but we're already on that slope. Put a toll transponder in your car. We've already seen these transponders used to track people. Next up, you'll get a ticket if you jump on a toll road and get from Exit A to Exit B in an average time that would exceed the speed limit.

      But why stop there? These things are cheap enough. Make them mandatory in all cars. Monitor your car speed through GPS. Violate the speed limit, get a ticket in the mail. Plus tracking devices can help the cops find any car at any time because they're ALL being tracked. That's a GOOD thing, right? Fight crime, right?

      This country is going to hell quickly. I fear for the life that my son is going to have.

      -S

      --
      --- What parts of "shall make no law", "shall not be infringed", and "shall not be violated" don't you understand?
    2. Re:The Cyber Archipelago by Noer · · Score: 4, Insightful

      You make some good points. Another way to look at this (esp. the whole Napster thing, or your speeding example) is that when a LARGE percentage of a population (need not be an actual majority) are breaking the same law, the law needs to be examined closely.

      Perhaps there's something quite wrong with society; if 30% of the population were murderers, this would definitely be the case. But perhaps it's an indication that the law should be changed. Should SO many people get speeding tickets all the time, especially when they're only a fraction ("selective enforcement" police units really scare me) of the total number of people speeding? Should everyone who used Napster be punished? Any society that has as large a percentage of its population in prison as ours does definitely has a problem (note: most of these people are in for drug-related offenses, which I think probably shouldn't be illegal).

      A friend of mine often rants against unenforced laws; he thinks the speeding laws should be STRICTLY enforced, so that people would get pissed and demand that the law be changed. Perhaps this is true; it's a variation on the idea that a society that criminalizes (whether or not it punishes) a large % of the population has a major problem.

      --
      -- "Those who cast the votes decide nothing. Those who count the votes decide everything." -Joseph Stalin
    3. Re:The Cyber Archipelago by ErikTheRed · · Score: 5, Insightful

      Speed monitoring has already been tried by car rental agencies, albeit without legal success.

      One of my biggest beefs with law in general is that there is far, far too much of it. Many laws are routinely disregarded by the population - underage drinking, speed limits on freeways, and especially taxes - because they are far too restrictive, to the point where they defy common sense. Because we (Americans, and I'm sure plenty of others) live in a land rife with dictu absurda, we have developed a sense that we only have to follow laws that makes sense to us.

      We also have a population largely willing to throw away its rights in order to combat the trendy social concern of the day. Of course, this is largely abetted by those with a political agenda that doesn't trust the common citizen to go about their day-to-day business without infinite hand-holding from big brother.

      In order to develop respect for the law, we need to have a set of laws worth respecting.

      --

      Help save the critically endangered Blue Iguana
    4. Re:The Cyber Archipelago by locust · · Score: 4, Interesting
      It won't be the police that demand it. It will be the insurance companies. They have a profit incentive to know if: you are driving regularly through a bad nieghborhood, driving too fast, driving farther than you tell them you drive to work. All of these things impinge upon the chances they will have to have to pay you if your car is stolen, crashed, etc. Further as large scale computing power becomes cheaper it will be come more practical to generate much more detailed actuarial tables that reflect these changes. These will translate into higher profits in the reinsurance market (insurers get insured against having to pay claims).

      Finally, when it comes down to having an extra 20 bucks a month to feed your kids, or having that extra bit of privacy, I'm pretty sure where most people will come down.

      --locust

    5. Re:The Cyber Archipelago by rcw-home · · Score: 1
      he thinks the speeding laws should be STRICTLY enforced, so that people would get pissed and demand that the law be changed

      I'd agree with this, however the last time I protested a sign post by obeying it, it put me in a situation where I could have been in an accident (I did 25mph on a 25mph two-lane road that could have easily been posted 35mph in spite of its many curves) when the truck tailgating me decided to cross the double line to pass me.

    6. Re:The Cyber Archipelago by Wah · · Score: 3, Informative
      It will be the insurance companies.

      It is also the defense companies. I can't look up the story I read about it (dang dial-up), but basically it was about the installation of speed monitoring cameras set-up in Wash, D.C. They had generated nearly $37 million for the city by snaggin every speeder. The fun part is that Lockheed Martin (IIRC) set them up for free...with a 35% take of the total revenue generated. So once, we start moving to a corporate police state, no one can break a law (get tough on "crime"), and ho boy will profits go through the roof.

      Bush might see this as "saving the economy", but a 5 year old would probably see it as cutting open the goose to get the golden egg. Our system worked because of Freedom, capitalism was a stepping stone (and a dang useful one at that, but it has its downsides, see: our media, MS, RIAA, drug corps ad'ing on TV selling drugs no one needs until they think they do, the death of education, and yes, there's an etc. here too).

      --
      +&x
    7. Re:The Cyber Archipelago by Anonymous Coward · · Score: 0

      And if the only people the insurance companies insure dont need insurance then what use are the insurance companies.

    8. Re:The Cyber Archipelago by Glock27 · · Score: 1
      The way things are headed, I can GUARANTEE you that things like speeding WILL INDEED be monitored. It starts slowly, but we're already on that slope. Put a toll transponder in your car. We've already seen these transponders used to track people [yahoo.com]. Next up, you'll get a ticket if you jump on a toll road and get from Exit A to Exit B in an average time that would exceed the speed limit.

      There's an even more straightforward method than the transponders - speed sensors along the freeway at frequent intervals coupled with still cameras. The sensors are already there in many places in California, for instance, see the San Diego Area Traffic Report page.

      As I understand it, systems like this coupled with cameras are already used to send automated tickets to people in Europe. Neat, eh?

      But why stop there? These things are cheap enough. Make them mandatory in all cars. Monitor your car speed through GPS. Violate the speed limit, get a ticket in the mail. Plus tracking devices can help the cops find any car at any time because they're ALL being tracked. That's a GOOD thing, right? Fight crime, right?

      This country is going to hell quickly. I fear for the life that my son is going to have.

      I couldn't agree more, and the 'no illegal surveillance' issue is one worth getting involved in. One good place to start is boycotting anything that promotes hidden cameras for anything. Spy TV and its ilk, for instance.

      Perhaps with enough public outcry we can prevent 1984 (ala George Orwell) from happening here in the US...but at this point I wouldn't count on it. Robert Heinlein was right on target many years ago (~30) when he pointed out that the US started on the road to hell when a national ID system was established. Now we have national crime databases, and a national police apparatus that grows ever stronger and prone to abuse. Time to colonize the ocean floor, or another planet...we desperately need a new frontier, with elbow room and actual freedom.

      186,282 mi/s...not just a good idea, its the law!

      --
      Galileo: "The Earth revolves around the Sun!"
      Score: -1 100% Flamebait
    9. Re:The Cyber Archipelago by Bluesee · · Score: 1

      One must ask the question: "Why are so many technological advances (e.g., echelon, carnivore, street cameras) being coupled with so many bad laws (UCITA, DMCA, incl Napster and MS rulings)?", and again, the answer seems to be that power begets power, ever ratcheting itself up to higher and higher levels through power acquisition. Here we see the mechanism by which power is obtained: again, in the Gulag Archipelago, the budding country needed powerful laws to effect its sweeping changes, so it came up with Article 58, which was very broadly stated and vague. The technology they used back then was the technology of persuasion (i.e., torture) to - in what must have somewhat inspired Orwell! - elicit confessions and enable the police to nab anyone at any time.

      Now we have this all-encompassing DCMA law and technologies like carnivore ready to enforce it. They go hand-in-hand, of course, and play into each other. We need Carnivore to enforce the DMCA; we need street cameras to prosecute the drug war (and helicopters and militia and battering ram tanks and don't get me started); we need the Maser gun to break up the riots. It is kind of a "military industrial complex" of law enforcement, and Disney wants it, and MS wants it, and Monsanto wants it - all to secure the revenue stream for their interests!

      Once this power is established it can be sold to the highest bidder - one of the more insightful points of the "Derek" story.

      I want a government limited in its power over people, but with enough power derived from the people to keep the corps properly regulated. But its not working that way. We instead have a government that is expanding its power, corporations that are reaping the benefits of that, and people who find their behaviors more and more circumscribed every day.

      --
      SDMI: Finally! Music that won't rip or burn! Brought to you by the fine folks at RIAA.
    10. Re:The Cyber Archipelago by Anonymous Coward · · Score: 0

      Wups, sorry, I didn't mean to link to an anti-Semite webpage... eeesh...

      Try this one instead

      Bluesee

    11. Re:The Cyber Archipelago by meldroc · · Score: 3, Informative

      Two of the nightmare examples stated in this thread have already come true. The state of Indiana will ticket drivers on their toll highways if the timestamps on their toll cards indicate they were driving faster than the speed limit, and Progressive Insurance has been testing a system where the insuree has a GPS device installed in their car, ostensibly for an insurance discount. If the car is driven at night, or through a bad neigborhood, premiums go up. Acme Auto Rental has been slapping people who speed in their rental cars with surcharges automatically added to their credit card bill.

      Smile for the unblinking camera and welcome to Hell.

      --

      Meldroc, Waster of Electrons
    12. Re:The Cyber Archipelago by Nemesis][ · · Score: 1

      But why stop there? These things are cheap enough. Make them mandatory in all cars. Monitor your car speed through GPS. Violate the speed limit, get a ticket in the mail. Plus tracking devices can help the cops find any car at any time because they're ALL being tracked. That's a GOOD thing, right? Fight crime, right?

      Ok, a bit offtopic here but why allow them to speed in the first place? Why not install a computer controlled governor? Cars are already getting fitted with a "Black Box", why not tack on GPS/map combo that knows the speed of the road?

      Loss of revenue for local police, major oil companies (run faster = burn more gas), places that produce high performance car parts...?

      Lunatic Asylum, n.: The place where optimism most flourishes.

    13. Re:The Cyber Archipelago by Anonymous Coward · · Score: 0

      And despite everything you said, you have a son.
      I don't understand some people.

    14. Re:The Cyber Archipelago by Polo · · Score: 2

      I was reading an article in Motorcyclist magazine this month regarding the use of cameras to monitor traffic violations.

      Apparently, the insurance companies have strategy of gradually introducing traffic cameras - not for speeding, but for red-lights. It seems that the general population would have a backlash against speed cameras, but not against red light cameras.

      What they found out is that most red-light offenses occur just when the light turns from red to yellow.

      Well, the truth of red-light cameras seems to be that they don't prevent accidents, but they generate revenues and traffic offenses (that allow the insurance companies to charge more money).

      However, to decrease the number of violations, it's quite easy to just add 1.5 seconds to the yellow light time and do away with the cameras. This might also make the intersections safer, (though there's no proof that just missing a red light leads to accidents statistically)

      But the big plan is to get cameras into society that are "acceptable", then quietly move onto other cameras. Like speed cameras.

      sigh.

    15. Re:The Cyber Archipelago by Jaysyn · · Score: 1

      I don't have a URL, but I read somewhere that the rental car company got in trouble for doing that, as it was an invasion of privacy.

      Jaysyn

      --
      There is a war going on for your mind.
    16. Re:The Cyber Archipelago by modemboy · · Score: 1

      Well, time to start wearing a ski mask while I drive... ;)

  82. Thank you! by Anonymous Coward · · Score: 0

    That pronunciation guide was very helpful!

  83. Russian Foreign Ministry warning means 1 thing: by thejake316 · · Score: 1

    Russian Foreign Ministry has warned its programmers not to travel to the United States.

    If that warning is heeded, it may mean the job market will open up for the programmers who were put on the dole after this economy and this stock market got a little more rational.

    --
    AC's cheerfully ignored
  84. Why are you so sure Dmitri is guilty? by sealawyer · · Score: 3, Insightful

    I've seen a number of posts suggesting that there is no doubt about Dmitri's guilt. Here is a list of conceivable ways that Dmitri could be found not guilty.

    1) The DMCA is unconstitutional. No valid law to break means not guilty.

    2) No jurisdiction over whatever activities Dmitri did commit. I don't think Dmitri can be prosecuted for writing or using the program in Russia. He must be implicated in the sales activity.

    3) Although Dmitri is the copyright holder, the government does not establish that he colluded with Elcomsoft to sell the product in the US. Most countries don't have the same kind of "work for hire" copyright laws as the US, so it is perfectly plausible for a Russian employee to be a credited with the copyright and yet not be the motivating factor in his employer's sales strategy.

    I haven't read the latest charges so I don't know what evidence the government has other than what was alleged in the original affidavit.

    For those people who want to see the whole thing played out to the end, there is this encouraging news from Dmitri's lawyer:

    Mr. Burton said Mr. Sklyarov would not plea-bargain. "That is out of the question," he said.

  85. Does anyone have Dmitry's address? by Anonymous Coward · · Score: -1, Troll

    I bought him a going away (to prison for at least 25 years) gift and I need to know where to send it. Don't tell him, but it's a tub of Vaseline. It's special heavy duty stuff too with the GOATSE SEAL OF APPROVAL!! It was very expensive. Please help me out here!

  86. Another Scopes "Monkey" trial by fiori · · Score: 1

    This could be as important as the Scopes Monkey trial was. In terms of legal and public exposure to an issue that much of the general public doesn't think is. It could make them confront the impact on 'fair-use' that the DCMA has. Only the technology early-adopters and the digeratti are aware of the DCMA's true scope. Let Bubba Joe know that the MPAA, RIAA, etc. really owns what's in his house and opinions will change.

    Let's hope it turns out better than that Scopes trial did initially.

  87. He's guilty and won't prevail by Anonymous Coward · · Score: 0
    IANAL,etc. but......


    1) Is Dimitri guilty of violating the DMCA? Yes, that seems clear.


    2) Is the DCMA enforcable against him? Pretty clear in the eys of US law enforcment. If Dimitri had committed an act in Russia which was legal in Russia, but criminal in the US, the US could not arrest Dimitry and enforce its laws upon him. The debate stems from the fact the US government sees the "sale" of this software as happening on US soil, not Russian, due to the fact that the payment and procurment of the software were both on US based servers. This is an important fact. A non US-based firm which has a US based presence that manufactures a US controlled substance is liable under US law. It is curious that Elcomsoft used US based servers when there are plenty of non-US alternatives. Was this poor judgment or was it intentional?


    3) Should the DCMA exist? Most US citizens don't know or care enough right now to cause it to be struck from the books through legislative means. And I think that right now it is unclear what the judicial system will ultimately decide.


    Though clearly guilty, a non guilty plea is the only means for Dimitry to bring enough exposure to this matter so that it can be fully vettted. My personal feeling is that Dimitry and Elcomsoft are liable under the DCMA, and that this case's fact pattern did not turn out to be as I had originally hoped.


    Unfortunately, I don't believe Dimitry's prospects to be that great.


    I would like to see a non US based firm sell DCMA violating sofware completly offshore with restrictions (which could be circumvented) on sale to US based customers. Then have this firm have its non US citizen programers tour around the US taunting law enforcment to "come and get me". That would be a much more interesing case.

    Too much of a coward to have a sig

  88. I have a few problems by Pinball+Wizard · · Score: 3, Insightful
    with the Skylarov case. First, there is a big difference between Ed Felton, who broke the SDMI encryption and Skylarov. Felton did his work as a purely academic excercise, whereas Skylarov made a product and distributed it for sale.


    Seems to me if Skylarov was only interested in promoting better security he wouldn't have tried to sell his product. This looks to me like someone trying to make a buck off an insecure product.


    Look at it another way. I come up with a key that can open and start any Ford vehicle. I have a couple of options. I could contact Ford and show them the tech that allows anyone to break into their vehicles. Or, if I don't want to deal with Ford directly I could publish the findings in an academic journal without trying to sell the key.


    Instead of doing that, however, I decide to market and sell keys that can break into every Ford. Now, don't you see what's wrong with that? I could have taken the high road, but instead I tried to make a buck. This is pretty much what Dmitry did.


    I can assure you, that if anyone tries to market a key that will unlock any Ford, that person will get thrown in jail if caught. Why should software be different?

    --

    No, Thursday's out. How about never - is never good for you?

    1. Re:I have a few problems by bnenning · · Score: 3, Insightful
      Seems to me if Skylarov was only interested in promoting better security he wouldn't have tried to sell his product.


      So what? Nowhere in the Constitution or Bill of Rights does it say that your rights can only be exercised for nonprofit purposes.


      I can assure you, that if anyone tries to market a key that will unlock any Ford, that person will get thrown in jail if caught.


      As usual, most real-world analogies don't work well here. Dmitry's program doesn't allow users to "unlock" any ebook, only ones that they actually own. The MPAA's description of DeCSS as a "digital crowbar" is actually more accurate. Crowbars have both legal and illegal uses, and it is not illegal to sell, possess, or describe how to make one.

      --
      How to solve most of our problems: 1.Lots of nuclear plants. 2.Cure aging.
    2. Re:I have a few problems by SirGeek · · Score: 1

      Its more analgous to "You own 4 Ford Cars, Someone makes a tool that allows you to use 1 key to operate all the vehicles (Provided you have the REAL keys) ..."

    3. Re:I have a few problems by Moridineas · · Score: 1

      Here here! Well said. Too many people here get rapped up in what a) others say and they take for pure fact, and b) whatever they think will get them more karma.

      thanks for bucking the trend.

      Scott

    4. Re:I have a few problems by Heph_Smith · · Score: 1

      Sorry but I have to say this....

      Its ignorant to think that because he worked for a company in another country that sold the product... that he should be given punishment because of their actions. I suppose if you looked into this subject at all before giving your opinion that it would have actually had facts and you would not have mentioned Skylarov as having "made a product and distributed it for sale"

      Hopefully that should clear up one of your problems that you mentioned.

      I won't even mention the analogy.

    5. Re:I have a few problems by Cardinal+Biggles · · Score: 2
      I can assure you, that if anyone tries to market a key that will unlock any Ford, that person will get thrown in jail if caught. Why should software be different?

      Because software is speech, not a physical object like a car-key.

      I agree that Ed Felten is on higher moral ground than Dmitry Sklyarov (or, actually, ElcomSoft his employer), even when taking into account the little fact that when you're a student in Russia you're going to need every buck you can possibly get so that you can feed your children.

      But that does not mean that he should go to jail. Nobody should go to jail for publishing software, because when you publish software, you are publishing an explanation, an opinion, an expression of ideas, in short: speech.

    6. Re:I have a few problems by dasunt · · Score: 2


      Actually, lets look at this analogy. Pick-guns, which, when they work, allows you to pick a lock in a few seconds, are legal to sell. Lock-picking knowledge is legal to distribute. Slimjims are legal to sell. Drill bits that can cut through hardened steel are legal.


      So, in a way, we have a few "keys", that although imperfect, will unlock most cars. They are legal to sell in the US. In a simular light, its legal for me to get the keycode off a lock cylinder of a car, go down to the locksmith, and get him to make me a key for that lock, without me ever showing proof that I own that vehicle or even have it in my possession. Its also legal for me to have someone travel to a specific location and have them unlock a vehicle for me with their knowledge and tools, and for them to bill me for their efforts.


      In short, the analogy stinks. Sorry.

    7. Re:I have a few problems by kreyg · · Score: 2

      Why should software be different?

      Uh... because in this case, after I drive away in "your" Ford... your Ford is still in the driveway.

      If I built a matter replicator and duplicated your Ford, then it would be a reasonable software analogy.

      And under the DMCA, the replicator wouldn't be illegal, but I wouldn't be able to give you one or tell you how to build one. That would be a real shame.

      --
      sig fault
    8. Re:I have a few problems by dpletche · · Score: 1

      Who said he was interested in improving e-book security? He was interested in enabling Russian consumers to exercise their LEGAL RIGHTS. In Russia it is explicitly legal to copy a work from one medium to another for personal use. In fact, it's even legal in this country, according to Senator Orrin Hatch. In a hearing on the DMCA, he observed:

      ''Can I make a copy of a CD that I buy and put it into a car?'' asked Hatch. When Rosen hemmed and hawed, Hatch muttered, ''The answer is yes.''
      (http://gareth.membrane.com/leflawnet/hatch.html )

      The DMCA contravenes and abrogates classical legal rights of citizens in the USA and around the world. Ironically, Adobe's e-book format illegally impedes the rights of Russian consumers according to Russian law. I'd love to see the outrage if Russia kidnapped some American executives and programmers to hold them trial for violating Russian laws protecting freedom of information.

    9. Re:I have a few problems by Legion303 · · Score: 1
      Seems to me if Skylarov was only interested in promoting better security he wouldn't have tried to sell his product.

      It wasn't his product. He's *one* programmer for the company ElcomSoft. He wasn't selling it, either. The sad part isn't the fact that you didn't bother to follow the case before commenting; the sad part is that neither did the idiots who modded you up to 3 for "insightful."

      -Legion

    10. Re:I have a few problems by razboinik · · Score: 1
      You are missing the point. Your Ford case should read like this:

      Ford makes a car that can only be started between 6 am and 9 pm. Sklyarov creates a product that allows *you* to start *your* car any time and sells it to you. Ford gets pissed off because they could allow turning the car on at any time for an additional charge.

      The deal is ebook restricts your rights and Dima's program reestablishes them.

      --
      (S)-1,2-methylenedioxy-4-(2-methylaminopropyl)-ben zene
    11. Re:I have a few problems by confidential · · Score: 2

      It's not so much "a key that can open any ford." Skylarov's company made software that allowed blind people to read their e-books. As adobe's software doesn't have text-to-speach, yet both MacOS and Windows have software readily available to do that (MacOS has it built in, Windows might as well, I'm not sure). Skylarov made a program that would decrypt the e-book and feed it to text-to-speach, allowing the purchaser the right to listen to the book.

      Now, as I understand, the DefCon people heard about this and knew what it meant (he cracked e-books) and asked him to give an academic presentation of how this was done. Skylarov did what Felton did, except he had a program out in the wild to show off how it worked.

      Back to the Ford example. How many people now have those IR car openers? Did anyone else see this story on slashdot? If people using palm software (I assume the software in question was OmniRemote) got between you and your car and intercepted the beam, you could have your car stolen. Does this mean that Palms should be illegial? no. OmniRemote is used for a universal remote, yet can be used to unlock any Ford. Skylarov's program gives blind people their rights, yet can be used to copy the e-book.

    12. Re:I have a few problems by Anonymous Coward · · Score: 1, Insightful

      Seems to me if Skylarov was only interested in promoting better security he wouldn't have tried to sell his product. This looks to me like someone trying to make a buck off an insecure product.

      Isn't that what Adobe did?

    13. Re:I have a few problems by Keith+McClary · · Score: 1

      Instead of doing that, however, I decide to market and sell keys that can break into every Ford. Now, don't you see what's wrong with that? I could have taken the high road, but instead I tried to make a buck. This is pretty much what Dmitry did.

      No. He assigned the rights to a company, which may have marketed the product illegally.

      You could sell your invention to a company with the intention that it would be marketed to legitimate users such as locksmiths. But suppose the company screws up and sells some to crooks - does that make you a criminal?

  89. warning! ASCII goatse.cx troll by Anonymous Coward · · Score: 0

    Danger, Will Robinson, Danger!

    warning! ASCII goatse.cx troll

  90. .. by Anonymous Coward · · Score: -1, Offtopic

    t5ke7oz8ml7du4tn1cm4ts1ax2jl5gs3rn8ml2up8nn5bp8eq5 eb5kh6vt3wj3hd8cr1rq6al2vj6tg1vz2an1ru1oj8vv5np5mu 8zu2xq2np1ld6wa5rx8dc0vp5yh6dg7fc2vq5qv4vp8ml9jw4f k2dy5ae8zr3oh5it4vv2qt2xq7rp7td5fz0ap9ni9mi7nk2ee3 yi1lu6vo1bh3sg5or6vm6kc2ic2vv0al1uj4ii6cm3cx4ym8gg 6qp5ys4zo7jv8oz2vc8kb4en0jm3jb6jj9gi3wy7gw2mx8fi1m z1mc5zr2fr7ce8pv3jf9hu0cq5va9oq3rv5rc3lv7zz6cn1vz7 mc5hw5af1cs3se4lw3fn3gu2gi3uc4rg6rm2ik5xp8bm6zc6dr 1gs3tz1za2nz5bx2vv1jn8aj7ok9se3mu7zu9zj7xd1vd5yf8u h6po7jq3ck1cr2sm4xj9aa7im6me5wk5jf2wt5mo1hm4wd3jc7 vb8tk9or7ti8ze4ac1sy3kw2ny7eu7sa4nv7zs9yo9ow5pb5bf 7fx5ox1hd9sd7si7al7bq2yd8vn5oa3te8ew7zk1gn5ou2zh8x j3hf6wq9nh6in9wj1jp8ij8mu1jt2jh1lm2tg7ah2ml2ej2hl4 ev1qn1yh0on3hd3ns7io1pe1ma0am7vr3gv4pd1el1kv7ey8pn 7hl5ti4gz7ew6ml8zl3so8hx3hs7pn9cy8nb2ux2or2ar7zh8k y5ok3nk2vo0uh9vy3cu3pp4zd4cf1si0tf1lp2ao1fy5sk1xe5 qp7em1fc5ed8ih3ah1yi3rc2jt3qc3ml7ac1hs8of6vn8zo1el 3np4pj5yy4mx8xn1me9yg2qz7aq6xl8cy4ld6us4wm5cl8tu5c y1ls8xe3rl2lb6lt9ia8uw9vr8kw2rs4vq6jx4ct5ke7oz8ml7 du4tn1cm4ts1ax2jl5gs3rn8ml2up8nn5bp8eq5eb5kh6vt3wj 3hd8cr1rq6al2vj6tg1vz2an1ru1oj8vv5np5mu8zu2xq2np1l d6wa5rx8dc0vp5yh6dg7fc2vq5qv4vp8ml9jw4fk2dy5ae8zr3 oh5it4vv2qt2xq7rp7td5fz0ap9ni9mi7nk2ee3yi1lu6vo1bh 3sg5or6vm6kc2ic2vv0al1uj4ii6cm3cx4ym8gg6qp5ys4zo7j v8oz2vc8kb4en0jm3jb6jj9gi3wy7gw2mx8fi1mz1mc5zr2fr7 ce8pv3jf9hu0cq5va9oq3rv5rc3lv7zz6cn1vz7mc5hw5af1cs 3se4lw3fn3gu2gi3uc4rg6rm2ik5xp8bm6zc6dr1gs3tz1za2n z5bx2vv1jn8aj7ok9se3mu7zu9zj7xd1vd5yf8uh6po7jq3ck1 cr2sm4xj9aa7im6me5wk5jf2wt5mo1hm4wd3jc7vb8tk9or7ti 8ze4ac1sy3kw2ny7eu7sa4nv7zs9yo9ow5pb5bf7fx5ox1hd9s d7si7al7bq2yd8vn5oa3te8ew7zk1gn5ou2zh8xj3hf6wq9nh6 in9wj1jp8ij8mu1jt2jh1lm2tg7ah2ml2ej2hl4ev1qn1yh0on 3hd3ns7io1pe1ma0am7vr3gv4pd1el1kv7ey8pn7hl5ti4gz7e w6ml8zl3so8hx3hs7pn9cy8nb2ux2or2ar7zh8ky5ok3nk2vo0 uh9vy3cu3pp4zd4cf1si0tf1lp2ao1fy5sk1xe5qp7em1fc5ed 8ih3ah1yi3rc2jt3qc3ml7ac1hs8of6vn8zo1el3np4pj5yy4m x8xn1me9yg2qz7aq6xl8cy4ld6us4wm5cl8tu5cy1ls8xe3rl2 lb6lt9ia8uw9vr8kw2rs4vq6jx4ct5ke7oz8ml7du4tn1cm4ts 1ax2jl5gs3rn8ml2up8nn5bp8eq5eb5kh6vt3wj3hd8cr1rq6a l2vj6tg1vz2an1ru1oj8vv5np5mu8zu2xq2np1ld6wa5rx8dc0 vp5yh6dg7fc2vq5qv4vp8ml9jw4fk2dy5ae8zr3oh5it4vv2qt 2xq7rp7td5fz0ap9ni9mi7nk2ee3yi1lu6vo1bh3sg5or6vm6k c2ic2vv0al1uj4ii6cm3cx4ym8gg6qp5ys4zo7jv8oz2vc8kb4 en0jm3jb6jj9gi3wy7gw2mx8fi1mz1mc5zr2fr7ce8pv3jf9hu 0cq5va9oq3rv5rc3lv7zz6cn1vz7mc5hw5af1cs3se4lw3fn3g u2gi3uc4rg6rm2ik5xp8bm6zc6dr1gs3tz1za2nz5bx2vv1jn8 aj7ok9se3mu7zu9zj7xd1vd5yf8uh6po7jq3ck1cr2sm4xj9aa 7im6me5wk5jf2wt5mo1hm4wd3jc7vb8tk9or7ti8ze4ac1sy3k w2ny7eu7sa4nv7zs9yo9ow5pb5bf7fx5ox1hd9sd7si7al7bq2 yd8vn5oa3te8ew7zk1gn5ou2zh8xj3hf6wq9nh6in9wj1jp8ij 8mu1jt2jh1lm2tg7ah2ml2ej2hl4ev1qn1yh0on3hd3ns7io1p e1ma0am7vr3gv4pd1el1kv7ey8pn7hl5ti4gz7ew6ml8zl3so8 hx3hs7pn9cy8nb2ux2or2ar7zh8ky5ok3nk2vo0uh9vy3cu3pp 4zd4cf1si0tf1lp2ao1fy5sk1xe5qp7em1fc5ed8ih3ah1yi3r c2jt3qc3ml7ac1hs8of6vn8zo1el3np4pj5yy4mx8xn1me9yg2 qz7aq6xl8cy4ld6us4wm5cl8tu5cy1ls8xe3rl2lb6lt9ia8uw 9vr8kw2rs4vq6jx4ct5ke7oz8ml7du4tn1cm4ts1ax2jl5gs3r n8ml2up8nn5bp8eq5eb5kh6vt3wj3hd8cr1rq6al2vj6tg1vz2 an1ru1oj8vv5np5mu8zu2xq2np1ld6wa5rx8dc0vp5yh6dg7fc 2vq5qv4vp8ml9jw4fk2dy5ae8zr3oh5it4vv2qt2xq7rp7td5f z0ap9ni9mi7nk2ee3yi1lu6vo1bh3sg5or6vm6kc2ic2vv0al1 uj4ii6cm3cx4ym8gg6qp5ys4zo7jv8oz2vc8kb4en0jm3jb6jj 9gi3wy7gw2mx8fi1mz1mc5zr2fr7ce8pv3jf9hu0cq5va9oq3r v5rc3lv7zz6cn1vz7mc5hw5af1cs3se4lw3fn3gu2gi3uc4rg6 rm2ik5xp8bm6zc6dr1gs3tz1za2nz5bx2vv1jn8aj7ok9se3mu 7zu9zj7xd1vd5yf8uh6po7jq3ck1cr2sm4xj9aa7im6me5wk5j f2wt5mo1hm4wd3jc7vb8tk9or7ti8ze4ac1sy3kw2ny7eu7sa4 nv7zs9yo9ow5pb5bf7fx5ox1hd9sd7si7al7bq2yd8vn5oa3te 8ew7zk1gn5ou2zh8xj3hf6wq9nh6in9wj1jp8ij8mu1jt2jh1l m2tg7ah2ml2ej2hl4ev1qn1yh0on3hd3ns7io1pe1ma0am7vr3 gv4pd1el1kv7ey8pn7hl5ti4gz7ew6ml8zl3so8hx3hs7pn9cy 8nb2ux2or2ar7zh8ky5ok3nk2vo0uh9vy3cu3pp4zd4cf1si0t f1lp2ao1fy5sk1xe5qp7em1fc5ed8ih3ah1yi3rc2jt3qc3ml7 ac1hs8of6vn8zo1el3np4pj5yy4mx8xn1me9yg2qz7aq6xl8cy 4ld6us4wm5cl8tu5cy1ls8xe3rl2lb6lt9ia8uw9vr8kw2rs4v q6jx4ct5ke7oz8ml7du4tn1cm4ts1ax2jl5gs3rn8ml2up8nn5 bp8eq5eb5kh6vt3wj3hd8cr1rq6al2vj6tg1vz2an1ru1oj8vv 5np5mu8zu2xq2np1ld6wa5rx8dc0vp5yh6dg7fc2vq5qv4vp8m l9jw4fk2dy5ae8zr3oh5it4vv2qt2xq7rp7td5fz0ap9ni9mi7 nk2ee3yi1lu6vo1bh3sg5or6vm6kc2ic2vv0al1uj4ii6cm3cx 4ym8gg6qp5ys4zo7jv8oz2vc8kb4en0jm3jb6jj9gi3wy7gw2m x8fi1mz1mc5zr2fr7ce8pv3jf9hu0cq5va9oq3rv5rc3lv7zz6 cn1vz7mc5hw5af1cs3se4lw3fn3gu2gi3uc4rg6rm2ik5xp8bm 6zc6dr1gs3tz1za2nz5bx2vv1jn8aj7ok9se3mu7zu9zj7xd1v d5yf8uh6po7jq3ck1cr2sm4xj9aa7im6me5wk5jf2wt5mo1hm4 wd3jc7vb8tk9or7ti8ze4ac1sy3kw2ny7eu7sa4nv7zs9yo9ow 5pb5bf7fx5ox1hd9sd7si7al7bq2yd8vn5oa3te8ew7zk1gn5o u2zh8xj3hf6wq9nh6in9wj1jp8ij8mu1jt2jh1lm2tg7ah2ml2 ej2hl4ev1qn1yh0on3hd3ns7io1pe1ma0am7vr3gv4pd1el1kv 7ey8pn7hl5ti4gz7ew6ml8zl3so8hx3hs7pn9cy8nb2ux2or2a r7zh8ky5ok3nk2vo0uh9vy3cu3pp4zd4cf1si0tf1lp2ao1fy5 sk1xe5qp7em1fc5ed8ih3ah1yi3rc2jt3qc3ml7ac1hs8of6vn 8zo1el3np4pj5yy4mx8xn1me9yg2qz7aq6xl8cy4ld6us4wm5c l8tu5cy1ls8xe3rl2lb6lt9ia8uw9vr8kw2rs4vq6jx4ct5ke7 oz8ml7du4tn1cm4ts1ax2jl5gs3rn8ml2up8nn5bp8eq5eb5kh 6vt3wj3hd8cr1rq6al2vj6tg1vz2an1ru1oj8vv5np5mu8zu2x q2np1ld6wa5rx8dc0vp5yh6dg7fc2vq5qv4vp8ml9jw4fk2dy5 ae8zr3oh5it4vv2qt2xq7rp7td5fz0ap9ni9mi7nk2ee3yi1lu 6vo1bh3sg5or6vm6kc2ic2vv0al1uj4ii6cm3cx4ym8gg6qp5y s4zo7jv8oz2vc8kb4en0jm3jb6jj9gi3wy7gw2mx8fi1mz1mc5 zr2fr7ce8pv3jf9hu0cq5va9oq3rv5rc3lv7zz6cn1vz7mc5hw 5af1cs3se4lw3fn3gu2gi3uc4rg6rm2ik5xp8bm6zc6dr1gs3t z1za2nz5bx2vv1jn8aj7ok9se3mu7zu9zj7xd1vd5yf8uh6po7 jq3ck1cr2sm4xj9aa7im6me5wk5jf2wt5mo1hm4wd3jc7vb8tk 9or7ti8ze4ac1sy3kw2ny7eu7sa4nv7zs9yo9ow5pb5bf7fx5o x1hd9sd7si7al7bq2yd8vn5oa3te8ew7zk1gn5ou2zh8xj3hf6 wq9nh6in9wj1jp8ij8mu1jt2jh1lm2tg7ah2ml2ej2hl4ev1qn 1yh0on3hd3ns7io1pe1ma0am7vr3gv4pd1el1kv7ey8pn7hl5t i4gz7ew6ml8zl3so8hx3hs7pn9cy8nb2ux2or2ar7zh8ky5ok3 nk2vo0uh9vy3cu3pp4zd4cf1si0tf1lp2ao1fy5sk1xe5qp7em 1fc5ed8ih3ah1yi3rc2jt3qc3ml7ac1hs8of6vn8zo1el3np4p j5yy4mx8xn1me9yg2qz7aq6xl8cy4ld6us4wm5cl8tu5cy1ls8 xe3rl2lb6lt9ia8uw9vr8kw2rs4vq6jx4ct5ke7oz8ml7du4tn 1cm4ts1ax2jl5gs3rn8ml2up8nn5bp8eq5eb5kh6vt3wj3hd8c r1rq6al2vj6tg1vz2an1ru1oj8vv5np5mu8zu2xq2np1ld6wa5 rx8dc0vp5yh6dg7fc2vq5qv4vp8ml9jw4fk2dy5ae8zr3oh5it 4vv2qt2xq7rp7td5fz0ap9ni9mi7nk2ee3yi1lu6vo1bh3sg5o r6vm6kc2ic2vv0al1uj4ii6cm3cx4ym8gg6qp5ys4zo7jv8oz2 vc8kb4en0jm3jb6jj9gi3wy7gw2mx8fi1mz1mc5zr2fr7ce8pv 3jf9hu0cq5va9oq3rv5rc3lv7zz6cn1vz7mc5hw5af1cs3se4l w3fn3gu2gi3uc4rg6rm2ik5xp8bm6zc6dr1gs3tz1za2nz5bx2 vv1jn8aj7ok9se3mu7zu9zj7xd1vd5yf8uh6po7jq3ck1cr2sm 4xj9aa7im6me5wk5jf2wt5mo1hm4wd3jc7vb8tk9or7ti8ze4a c1sy3kw2ny7eu7sa4nv7zs9yo9ow5pb5bf7fx5ox1hd9sd7si7 al7bq2yd8vn5oa3te8ew7zk1gn5ou2zh8xj3hf6wq9nh6in9wj 1jp8ij8mu1jt2jh1lm2tg7ah2ml2ej2hl4ev1qn1yh0on3hd3n s7io1pe1ma0am7vr3gv4pd1el1kv7ey8pn7hl5ti4gz7ew6ml8 zl3so8hx3hs7pn9cy8nb2ux2or2ar7zh8ky5ok3nk2vo0uh9vy 3cu3pp4zd4cf1si0tf1lp2ao1fy5sk1xe5qp7em1fc5ed8ih3a h1yi3rc2jt3qc3ml7ac1hs8of6vn8zo1el3np4pj5yy4mx8xn1 me9yg2qz7aq6xl8cy4ld6us4wm5cl8tu5cy1ls8xe3rl2lb6lt 9ia8uw9vr8kw2rs4vq6jx4ct5ke7oz8ml7du4tn1cm4ts1ax2j l5gs3rn8ml2up8nn5bp8eq5eb5kh6vt3wj3hd8cr1rq6al2vj6 tg1vz2an1ru1oj8vv5np5mu8zu2xq2np1ld6wa5rx8dc0vp5yh 6dg7fc2vq5qv4vp8ml9jw4fk2dy5ae8zr3oh5it4vv2qt2xq7r p7td5fz0ap9ni9mi7nk2ee3yi1lu6vo1bh3sg5or6vm6kc2ic2 vv0al1uj4ii6cm3cx4ym8gg6qp5ys4zo7jv8oz2vc8kb4en0jm 3jb6jj9gi3wy7gw2mx8fi1mz1mc5zr2fr7ce8pv3jf9hu0cq5v a9oq3rv5rc3lv7zz6cn1vz7mc5hw5af1cs3se4lw3fn3gu2gi3 uc4rg6rm2ik5xp8bm6zc6dr1gs3tz1za2nz5bx2vv1jn8aj7ok 9se3mu7zu9zj7xd1vd5yf8uh6po7jq3ck1cr2sm4xj9aa7im6m e5wk5jf2wt5mo1hm4wd3jc7vb8tk9or7ti8ze4ac1sy3kw2ny7 eu7sa4nv7zs9yo9ow5pb5bf7fx5ox1hd9sd7si7al7bq2yd8vn 5oa3te8ew7zk1gn5ou2zh8xj3hf6wq9nh6in9wj1jp8ij8mu1j t2jh1lm2tg7ah2ml2ej2hl4ev1qn1yh0on3hd3ns7io1pe1ma0 am7vr3gv4pd1el1kv7ey8pn7hl5ti4gz7ew6ml8zl3so8hx3hs 7pn9cy8nb2ux2or2ar7zh8ky5ok3nk2vo0uh9vy3cu3pp4zd4c f1si0tf1lp2ao1fy5sk1xe5qp7em1fc5ed8ih3ah1yi3rc2jt3 qc3ml7ac1hs8of6vn8zo1el3np4pj5yy4mx8xn1me9yg2qz7aq 6xl8cy4ld6us4wm5cl8tu5cy1ls8xe3rl2lb6lt9ia8uw9vr8k w2rs4vq6jx4ct5ke7oz8ml7du4tn1cm4ts1ax2jl5gs3rn8ml2 up8nn5bp8eq5eb5kh6vt3wj3hd8cr1rq6al2vj6tg1vz2an1ru 1oj8vv5np5mu8zu2xq2np1ld6wa5rx8dc0vp5yh6dg7fc2vq5q v4vp8ml9jw4fk2dy5ae8zr3oh5it4vv2qt2xq7rp7td5fz0ap9 ni9mi7nk2ee3yi1lu6vo1bh3sg5or6vm6kc2ic2vv0al1uj4ii 6cm3cx4ym8gg6qp5ys4zo7jv8oz2vc8kb4en0jm3jb6jj9gi3w y7gw2mx8fi1mz1mc5zr2fr7ce8pv3jf9hu0cq5va9oq3rv5rc3 lv7zz6cn1vz7mc5hw5af1cs3se4lw3fn3gu2gi3uc4rg6rm2ik 5xp8bm6zc6dr1gs3tz1za2nz5bx2vv1jn8aj7ok9se3mu7zu9z j7xd1vd5yf8uh6po7jq3ck1cr2sm4xj9aa7im6me5wk5jf2wt5 mo1hm4wd3jc7vb8tk9or7ti8ze4ac1sy3kw2ny7eu7sa4nv7zs 9yo9ow5pb5bf7fx5ox1hd9sd7si7al7bq2yd8vn5oa3te8ew7z k1gn5ou2zh8xj3hf6wq9nh6in9wj1jp8ij8mu1jt2jh1lm2tg7 ah2ml2ej2hl4ev1qn1yh0on3hd3ns7io1pe1ma0am7vr3gv4pd 1el1kv7ey8pn7hl5ti4gz7ew6ml8zl3so8hx3hs7pn9cy8nb2u x2or2ar7zh8ky5ok3nk2vo0uh9vy3cu3pp4zd4cf1si0tf1lp2 ao1fy5sk1xe5qp7em1fc5ed8ih3ah1yi3rc2jt3qc3ml7ac1hs 8of6vn8zo1el3np4pj5yy4mx8xn1me9yg2qz7aq6xl8cy4ld6u s4wm5cl8tu5cy1ls8xe3rl2lb6lt9ia8uw9vr8kw2rs4vq6jx4 ct5ke7oz8ml7du4tn1cm4ts1ax2jl5gs3rn8ml2up8nn5bp8eq 5eb5kh6vt3wj3hd8cr1rq6al2vj6tg1vz2an1ru1oj8vv5np5m u8zu2xq2np1ld6wa5rx8dc0vp5yh6dg7fc2vq5qv4vp8ml9jw4 fk2dy5ae8zr3oh5it4vv2qt2xq7rp7td5fz0ap9ni9mi7nk2ee 3yi1lu6vo1bh3sg5or6vm6kc2ic2vv0al1uj4ii6cm3cx4ym8g g6qp5ys4zo7jv8oz2vc8kb4en0jm3jb6jj9gi3wy7gw2mx8fi1 mz1mc5zr2fr7ce8pv3jf9hu0cq5va9oq3rv5rc3lv7zz6cn1vz 7mc5hw5af1cs3se4lw3fn3gu2gi3uc4rg6rm2ik5xp8bm6zc6d r1gs3tz1za2nz5bx2vv1jn8aj7ok9se3mu7zu9zj7xd1vd5yf8 uh6po7jq3ck1cr2sm4xj9aa7im6me5wk5jf2wt5mo1hm4wd3jc 7vb8tk9or7ti8ze4ac1sy3kw2ny7eu7sa4nv7zs9yo9ow5pb5b f7fx5ox1hd9sd7si7al7bq2yd8vn5oa3te8ew7zk1gn5ou2zh8 xj3hf6wq9nh6in9wj1jp8ij8mu1jt2jh1lm2tg7ah2ml2ej2hl 4ev1qn1yh0on3hd3ns7io1pe1ma0am7vr3gv4pd1el1kv7ey8p n7hl5ti4gz7ew6ml8zl3so8hx3hs7pn9cy8nb2ux2or2ar7zh8 ky5ok3nk2vo0uh9vy3cu3pp4zd4cf1si0tf1lp2ao1fy5sk1xe 5qp7em1fc5ed8ih3ah1yi3rc2jt3qc3ml7ac1hs8of6vn8zo1e l3np4pj5yy4mx8xn1me9yg2qz7aq6xl8cy4ld6us4wm5cl8tu5 cy1ls8xe3rl2lb6lt9ia8uw9vr8kw2rs4vq6jx4ct5ke7oz8ml 7du4tn1cm4ts1ax2jl5gs3rn8ml2up8nn5bp8eq5eb5kh6vt3w j3hd8cr1rq6al2vj6tg1vz2an1ru1oj8vv5np5mu8zu2xq2np1 ld6wa5rx8dc0vp5yh6dg7fc2vq5qv4vp8ml9jw4fk2dy5ae8zr 3oh5it4vv2qt2xq7rp7td5fz0ap9ni9mi7nk2ee3yi1lu6vo1b h3sg5or6vm6kc2ic2vv0al1uj4ii6cm3cx4ym8gg6qp5ys4zo7 jv8oz2vc8kb4en0jm3jb6jj9gi3wy7gw2mx8fi1mz1mc5zr2fr 7ce8pv3jf9hu0cq5va9oq3rv5rc3lv7zz6cn1vz7mc5hw5af1c s3se4lw3fn3gu2gi3uc4rg6rm2ik5xp8bm6zc6dr1gs3tz1za2 nz5bx2vv1jn8aj7ok9se3mu7zu9zj7xd1vd5yf8uh6po7jq3ck 1cr2sm4xj9aa7im6me5wk5jf2wt5mo1hm4wd3jc7vb8tk9or7t i8ze4ac1sy3kw2ny7eu7sa4nv7zs9yo9ow5pb5bf7fx5ox1hd9 sd7si7al7bq2yd8vn5oa3te8ew7zk1gn5ou2zh8xj3hf6wq9nh 6in9wj1jp8ij8mu1jt2jh1lm2tg7ah2ml2ej2hl4ev1qn1yh0o n3hd3ns7io1pe1ma0am7vr3gv4pd1el1kv7ey8pn7hl5ti4gz7 ew6ml8zl3so8hx3hs7pn9cy8nb2ux2or2ar7zh8ky5ok3nk2vo 0uh9vy3cu3pp4zd4cf1si0tf1lp2ao1fy5sk1xe5qp7em1fc5e d8ih3ah1yi3rc2jt3qc3ml7ac1hs8of6vn8zo1el3np4pj5yy4 mx8xn1me9yg2qz7aq6xl8cy4ld6us4wm5cl8tu5cy1ls8xe3rl 2lb6lt9ia8uw9vr8kw2rs4vq6jx4ct5ke7oz8ml7du4tn1cm4t s1ax2jl5gs3rn8ml2up8nn5bp8eq5eb5kh6vt3wj3hd8cr1rq6 al2vj6tg1vz2an1ru1oj8vv5np5mu8zu2xq2np1ld6wa5rx8dc 0vp5yh6dg7fc2vq5qv4vp8ml9jw4fk2dy5ae8zr3oh5it4vv2q t2xq7rp7td5fz0ap9ni9mi7nk2ee3yi1lu6vo1bh3sg5or6vm6 kc2ic2vv0al1uj4ii6cm3cx4ym8gg6qp5ys4zo7jv8oz2vc8kb 4en0jm3jb6jj9gi3wy7gw2mx8fi1mz1mc5zr2fr7ce8pv3jf9h u0cq5va9oq3rv5rc3lv7zz6cn1vz7mc5hw5af1cs3se4lw3fn3 gu2gi3uc4rg6rm2ik5xp8bm6zc6dr1gs3tz1za2nz5bx2vv1jn 8aj7ok9se3mu7zu9zj7xd1vd5yf8uh6po7jq3ck1cr2sm4xj9a a7im6me5wk5jf2wt5mo1hm4wd3jc7vb8tk9or7ti8ze4ac1sy3 kw2ny7eu7sa4nv7zs9yo9ow5pb5bf7fx5ox1hd9sd7si7al7bq 2yd8vn5oa3te8ew7zk1gn5ou2zh8xj3hf6wq9nh6in9wj1jp8i j8mu1jt2jh1lm2tg7ah2ml2ej2hl4ev1qn1yh0on3hd3ns7io1 pe1ma0am7vr3gv4pd1el1kv7ey8pn7hl5ti4gz7ew6ml8zl3so 8hx3hs7pn9cy8nb2ux2or2ar7zh8ky5ok3nk2vo0uh9vy3cu3p p4zd4cf1si0tf1lp2ao1fy5sk1xe5qp7em1fc5ed8ih3ah1yi3 rc2jt3qc3ml7ac1hs8of6vn8zo1el3np4pj5yy4mx8xn1me9yg 2qz7aq6xl8cy4ld6us4wm5cl8tu5cy1ls8xe3rl2lb6lt9ia8u w9vr8kw2rs4vq6jx4ct5ke7oz8ml7du4tn1cm4ts1ax2jl5gs3 rn8ml2up8nn5bp8eq5eb5kh6vt3wj3hd8cr1rq6al2vj6tg1vz 2an1ru1oj8vv5np5mu8zu2xq2np1ld6wa5rx8dc0vp5yh6dg7f c2vq5qv4vp8ml9jw4fk2dy5ae8zr3oh5it4vv2qt2xq7rp7td5 fz0ap9ni9mi7nk2ee3yi1lu6vo1bh3sg5or6vm6kc2ic2vv0al 1uj4ii6cm3cx4ym8gg6qp5ys4zo7jv8oz2vc8kb4en0jm3jb6j j9gi3wy7gw2mx8fi1mz1mc5zr2fr7ce8pv3jf9hu0cq5va9oq3 rv5rc3lv7zz6cn1vz7mc5hw5af1cs3se4lw3fn3gu2gi3uc4rg 6rm2ik5xp8bm6zc6dr1gs3tz1za2nz5bx2vv1jn8aj7ok9se3m u7zu9zj7xd1vd5yf8uh6po7jq3ck1cr2sm4xj9aa7im6me5wk5 jf2wt5mo1hm4wd3jc7vb8tk9or7ti8ze4ac1sy3kw2ny7eu7sa 4nv7zs9yo9ow5pb5bf7fx5ox1hd9sd7si7al7bq2yd8vn5oa3t e8ew7zk1gn5ou2zh8xj3hf6wq9nh6in9wj1jp8ij8mu1jt2jh1 lm2tg7ah2ml2ej2hl4ev1qn1yh0on3hd3ns7io1pe1ma0am7vr 3gv4pd1el1kv7ey8pn7hl5ti4gz7ew6ml8zl3so8hx3hs7pn9c y8nb2ux2or2ar7zh8ky5ok3nk2vo0uh9vy3cu3pp4zd4cf1si0 tf1lp2ao1fy5sk1xe5qp7em1fc5ed8ih3ah1yi3rc2jt3qc3ml 7ac1hs8of6vn8zo1el3np4pj5yy4mx8xn1me9yg2qz7aq6xl8c y4ld6us4wm5cl8tu5cy1ls8xe3rl2lb6lt9ia8uw9vr8kw2rs4 vq6jx4ct5ke7oz8ml7du4tn1cm4ts1ax2jl5gs3rn8ml2up8nn 5bp8eq5eb5kh6vt3wj3hd8cr1rq6al2vj6tg1vz2an1ru1oj8v v5np5mu8zu2xq2np1ld6wa5rx8dc0vp5yh6dg7fc2vq5qv4vp8 ml9jw4fk2dy5ae8zr3oh5it4vv2qt2xq7rp7td5fz0ap9ni9mi 7nk2ee3yi1lu6vo1bh3sg5or6vm6kc2ic2vv0al1uj4ii6cm3c x4ym8gg6qp5ys4zo7jv8oz2vc8kb4en0jm3jb6jj9gi3wy7gw2 mx8fi1mz1mc5zr2fr7ce8pv3jf9hu0cq5va9oq3rv5rc3lv7zz 6cn1vz7mc5hw5af1cs3se4lw3fn3gu2gi3uc4rg6rm2ik5xp8b m6zc6dr1gs3tz1za2nz5bx2vv1jn8aj7ok9se3mu7zu9zj7xd1 vd5yf8uh6po7jq3ck1cr2sm4xj9aa7im6me5wk5jf2wt5mo1hm 4wd3jc7vb8tk9or7ti8ze4ac1sy3kw2ny7eu7sa4nv7zs9yo9o w5pb5bf7fx5ox1hd9sd7si7al7bq2yd8vn5oa3te8ew7zk1gn5 ou2zh8xj3hf6wq9nh6in9wj1jp8ij8mu1jt2jh1lm2tg7ah2ml 2ej2hl4ev1qn1yh0on3hd3ns7io1pe1ma0am7vr3gv4pd1el1k v7ey8pn7hl5ti4gz7ew6ml8zl3so8hx3hs7pn9cy8nb2ux2or2 ar7zh8ky5ok3nk2vo0uh9vy3cu3pp4zd4cf1si0tf1lp2ao1fy 5sk1xe5qp7em1fc5ed8ih3ah1yi3rc2jt3qc3ml7ac1hs8of6v n8zo1el3np4pj5yy4mx8xn1me9yg2qz7aq6xl8cy4ld6us4wm5 cl8tu5cy1ls8xe3rl2lb6lt9ia8uw9vr8kw2rs4vq6jx4ct5ke 7oz8ml7du4tn1cm4ts1ax2jl5gs3rn8ml2up8nn5bp8eq5eb5k h6vt3wj3hd8cr1rq6al2vj6tg1vz2an1ru1oj8vv5np5mu8zu2 xq2np1ld6wa5rx8dc0vp5yh6dg7fc2vq5qv4vp8ml9jw4fk2dy 5ae8zr3oh5it4vv2qt2xq7rp7td5fz0ap9ni9mi7nk2ee3yi1l u6vo1bh3sg5or6vm6kc2ic2vv0al1uj4ii6cm3cx4ym8gg6qp5 ys4zo7jv8oz2vc8kb4en0jm3jb6jj9gi3wy7gw2mx8fi1mz1mc 5zr2fr7ce8pv3jf9hu0cq5va9oq3rv5rc3lv7zz6cn1vz7mc5h w5af1cs3se4lw3fn3gu2gi3uc4rg6rm2ik5xp8bm6zc6dr1gs3 tz1za2nz5bx2vv1jn8aj7ok9se3mu7zu9zj7xd1vd5yf8uh6po 7jq3ck1cr2sm4xj9aa7im6me5wk5jf2wt5mo1hm4wd3jc7vb8t k9or7ti8ze4ac1sy3kw2ny7eu7sa4nv7zs9yo9ow5pb5bf7fx5 ox1hd9sd7si7al7bq2yd8vn5oa3te8ew7zk1gn5ou2zh8xj3hf 6wq9nh6in9wj1jp8ij8mu1jt2jh1lm2tg7ah2ml2ej2hl4ev1q n1yh0on3hd3ns7io1pe1ma0am7vr3gv4pd1el1kv7ey8pn7hl5 ti4gz7ew6ml8zl3so8hx3hs7pn9cy8nb2ux2or2ar7zh8ky5ok 3nk2vo0uh9vy3cu3pp4zd4cf1si0tf1lp2ao1fy5sk1xe5qp7e m1fc5ed8ih3ah1yi3rc2jt3qc3ml7ac1hs8of6vn8zo1el3np4 pj5yy4mx8xn1me9yg2qz7aq6xl8cy4ld6us4wm5cl8tu5cy1ls 8xe3rl2lb6lt9ia8uw9vr8kw2rs4vq6jx4ct5ke7oz8ml7du4t n1cm4ts1ax2jl5gs3rn8ml2up8nn5bp8eq5eb5kh6vt3wj3hd8 cr1rq6al2vj6tg1vz2an1ru1oj8vv5np5mu8zu2xq2np1ld6wa 5rx8dc0vp5yh6dg7fc2vq5qv4vp8ml9jw4fk2dy5ae8zr3oh5i t4vv2qt2xq7rp7td5fz0ap9ni9mi7nk2ee3yi1lu6vo1bh3sg5 or6vm6kc2ic2vv0al1uj4ii6cm3cx4ym8gg6qp5ys4zo7jv8oz 2vc8kb4en0jm3jb6jj9gi3wy7gw2mx8fi1mz1mc5zr2fr7ce8p v3jf9hu0cq5va9oq3rv5rc3lv7zz6cn1vz7mc5hw5af1cs3se4 lw3fn3gu2gi3uc4rg6rm2ik5xp8bm6zc6dr1gs3tz1za2nz5bx 2vv1jn8aj7ok9se3mu7zu9zj7xd1vd5yf8uh6po7jq3ck1cr2s m4xj9aa7im6me5wk5jf2wt5mo1hm4wd3jc7vb8tk9or7ti8ze4 ac1sy3kw2ny7eu7sa4nv7zs9yo9ow5pb5bf7fx5ox1hd9sd7si 7al7bq2yd8vn5oa3te8ew7zk1gn5ou2zh8xj3hf6wq9nh6in9w j1jp8ij8mu1jt2jh1lm2tg7ah2ml2ej2hl4ev1qn1yh0on3hd3 ns7io1pe1ma0am7vr3gv4pd1el1kv7ey8pn7hl5ti4gz7ew6ml 8zl3so8hx3hs7pn9cy8nb2ux2or2ar7zh8ky5ok3nk2vo0uh9v y3cu3pp4zd4cf1si0tf1lp2ao1fy5sk1xe5qp7em1fc5ed8ih3 ah1yi3rc2jt3qc3ml7ac1hs8of6vn8zo1el3np4pj5yy4mx8xn 1me9yg2qz7aq6xl8cy4ld6us4wm5cl8tu5cy1ls8xe3rl2lb6l t9ia8uw9vr8kw2rs4vq6jx4ct5ke7oz8ml7du4tn1cm4ts1ax2 jl5gs3rn8ml2up8nn5bp8eq5eb5kh6vt3wj3hd8cr1rq6al2vj 6tg1vz2an1ru1oj8vv5np5mu8zu2xq2np1ld6wa5rx8dc0vp5y h6dg7fc2vq5qv4vp8ml9jw4fk2dy5ae8zr3oh5it4vv2qt2xq7 rp7td5fz0ap9ni9mi7nk2ee3yi1lu6vo1bh3sg5or6vm6kc2ic 2vv0al1uj4ii6cm3cx4ym8gg6qp5ys4zo7jv8oz2vc8kb4en0j m3jb6jj9gi3wy7gw2mx8fi1mz1mc5zr2fr7ce8pv3jf9hu0cq5 va9oq3rv5rc3lv7zz6cn1vz7mc5hw5af1cs3se4lw3fn3gu2gi 3uc4rg6rm2ik5xp8bm6zc6dr1gs3tz1za2nz5bx2vv1jn8aj7o k9se3mu7zu9zj7xd1vd5yf8uh6po7jq3ck1cr2sm4xj9aa7im6 me5wk5jf2wt5mo1hm4wd3jc7vb8tk9or7ti8ze4ac1sy3kw2ny 7eu7sa4nv7zs9yo9ow5pb5bf7fx5ox1hd9sd7si7al7bq2yd8v n5oa3te8ew7zk1gn5ou2zh8xj3hf6wq9nh6in9wj1jp8ij8mu1 jt2jh1lm2tg7ah2ml2ej2hl4ev1qn1yh0on3hd3ns7io1pe1ma 0am7vr3gv4pd1el1kv7ey8pn7hl5ti4gz7ew6ml8zl3so8hx3h s7pn9cy8nb2ux2or2ar7zh8ky5ok3nk2vo0uh9vy3cu3pp4zd4 cf1si0tf1lp2ao1fy5sk1xe5qp7em1fc5ed8ih3ah1yi3rc2jt 3qc3ml7ac1hs8of6vn8zo1el3np4pj5yy4mx8xn1me9yg2qz7a q6xl8cy4ld6us4wm5cl8tu5cy1ls8xe3rl2lb6lt9ia8uw9vr8 kw2rs4vq6jx4ct5ke7oz8ml7du4tn1cm4ts1ax2jl5gs3rn8ml 2up8nn5bp8eq5eb5kh6vt3wj3hd8cr1rq6al2vj6tg1vz2an1r u1oj8vv5np5mu8zu2xq2np1ld6wa5rx8dc0vp5yh6dg7fc2vq5 qv4vp8ml9jw4fk2dy5ae8zr3oh5it4vv2qt2xq7rp7td5fz0ap 9ni9mi7nk2ee3yi1lu6vo1bh3sg5or6vm6kc2ic2vv0al1uj4i i6cm3cx4ym8gg6qp5ys4zo7jv8oz2vc8kb4en0jm3jb6jj9gi3 wy7gw2mx8fi1mz1mc5zr2fr7ce8pv3jf9hu0cq5va9oq3rv5rc 3lv7zz6cn1vz7mc5hw5af1cs3se4lw3fn3gu2gi3uc4rg6rm2i k5xp8bm6zc6dr1gs3tz1za2nz5bx2vv1jn8aj7ok9se3mu7zu9 zj7xd1vd5yf8uh6po7jq3ck1cr2sm4xj9aa7im6me5wk5jf2wt 5mo1hm4wd3jc7vb8tk9or7ti8ze4ac1sy3kw2ny7eu7sa4nv7z s9yo9ow5pb5bf7fx5ox1hd9sd7si7al7bq2yd8vn5oa3te8ew7 zk1gn5ou2zh8xj3hf6wq9nh6in9wj1jp8ij8mu1jt2jh1lm2tg 7ah2ml2ej2hl4ev1qn1yh0on3hd3ns7io1pe1ma0am7vr3gv4p d1el1kv7ey8pn7hl5ti4gz7ew6ml8zl3so8hx3hs7pn9cy8nb2 ux2or2ar7zh8ky5ok3nk2vo0uh9vy3cu3pp4zd4cf1si0tf1lp 2ao1fy5sk1xe5qp7em1fc5ed8ih3ah1yi3rc2jt3qc3ml7ac1h s8of6vn8zo1el3np4pj5yy4mx8xn1me9yg2qz7aq6xl8cy4ld6 us4wm5cl8tu5cy1ls8xe3rl2lb6lt9ia8uw9vr8kw2rs4vq6jx 4c

  91. 21 Century version of the Printing Press by Metox · · Score: 1

    As I was reading the various posts on this thread, I was struck by an interesting similarity.

    Regress back to the 15th and 16th centuries. All written material was created by people who could write (scribes). Commissioned by people who could pay (Royalty). In a language that that is now dead (Latin).

    There were attempts to produce written works in a country's (European) native language, but these were expensive, (scribes) and consequently not available to the general (peasant) population.

    Enter the Printing Press (Gutenberg) and lo, thow can have a book printed in a national language, for a miniscule cost. Books of knowledge exploded onto the scene. The general populace was no longer handicaped by a lack of readily available research. No longer would the knowledge that had been so closely garded (encrypted?) by the Latin speaking world be inaccessable to the masses.

    Sklyarov and other cryptologists are merely carrying on the Gutenberg tradition of making knowledge available to the masses.

    Then again, what would Gutenberg have thought of Romance Novels?

    Ps. Until money grepping legislation like the dmca (it doesn't deserve an acronym) is removed, digital books will never catch on. I see Books (paper and ink) staying around for a long time.

    --
    "Chemestry is Physics without thought. Mathematics is Physics without purpose."
  92. I don't like this as much as the next guy but.... by BombTechnician · · Score: 1

    Reading through the indictment, I saw that this is accaptable due to the fact that it is upholding the law. But I feel that they have the wrong person. If legal action were to be taken against anyone, Elcomsoft would be it. Dmitry was only an employee, doing his job. Elcom decided to sell his work. Now if Dmitry had posted it himself, it would be a different story. But Elcom didn't _have_ to release the software.
    But IANAL, so mabey I'm way off base.
    (And go ahead and give me a redundant, i care not)

    --

    If you see me running, try and keep up
    There's a good chance I don't know what the hell I'm talking about
  93. Some implications of this & the Oz news by jd · · Score: 4, Funny
    It seems clear that any action carried out in ANY other country may be grounds for prosecution in ANY OTHER country. (Australia now permits overseas defamation lawsuits, for example.)

    It follows that:

    • Anyone in the US can be tried and convicted of posession of a firearm, should they go to the United Kingdom, whether or not they bring any firearms with them.
    • Anyone in the US who publishes more than 1/3 of their news material in English can be convicted in France for inadequate use of French.
    • Anyone practicing medicine in the US is in -serious- trouble, unless licenced in all 50 States. Practicing -anywhere- in the US could be grounds for deportation and conviction in a State for which the doctor has no licence.

    These sound crazy, don't they? But, really, what's the difference between a South Carolina doctor being convicted of practicing in South Carolina, without a California licence, and some Russian geek being convicted of DMCA "violations" arising from work in Russia?

    Well, other than Russia is a lot further away, isn't even part of the US, and other such details. The doctor example I gave would actually be far more reasonable. At least the alleged events would have happened on the same Continent!

    --
    It's a small world and it smells funny; I'd buy another if it wasn't for the money; Take back what I paid (SoM)
    1. Re:Some implications of this & the Oz news by t_allardyce · · Score: 1

      Yes, but in England, we don't have stupid laws that allow you to be arrested for writing (what was effectively a "print screen and then page down" program (yes i know it didn't do that but _effectively_ it did) in _another_ country! And after seeing its effects hopefully even the dumb Blair will figure out whats right.

      And don't write a reply to this mentioning our gun laws lol...

      --
      This comment does not represent the views or opinions of the user.
    2. Re:Some implications of this & the Oz news by jd · · Score: 2
      I quite agree. We just have laws that allow you to be arrested if you look "odd" ("Terrorism Prevention Act"), visit the wrong country (see the TV documentary "Death on the Rock"), belong to CND ("Potential Subversive"), or walk down a footpath with some friends ("Criminal Justice Act").


      That said, I =like= the English justice system a whole lot better than the systems used by other countries, ESPECIALLY the United States. It gets a lot of things wrong, it has an attitude problem from hell, and Jack Straw is Scarecrow's dumber twin. But at least it makes an effort, and the House of Lords isn't entirely politically biased.

      --
      It's a small world and it smells funny; I'd buy another if it wasn't for the money; Take back what I paid (SoM)
    3. Re:Some implications of this & the Oz news by Anonymous Coward · · Score: 0

      The cases you cite are not parallel at all, since the program was sold primarily to people in the US. A more similar case, (if breaking encryption really was immoral), would be a group of people in the US selling submachine guns to terrorists in Northern Ireland. Obviously a law has been broken here, and the British government has jurisdiction. It would be stupid to travel to London and talk about how great your illegal business is working.

      That said, breaking encryption should not be illegal. It is a totally separate act from making copies and distributing them. And I still can't believe that they actually arrested the programmer, who presumably has nothing with selling the product in US markets.

    4. Re:Some implications of this & the Oz news by metachimp · · Score: 1

      Actually in that case, it would be just as likely to get busted for it here, too. Last I checked it was illegal to sell submachine guns without a license. Additionally, there may be a law specifically stating that if you're caught trying to sell guns to terrorists in the US, they throw the book at you. The British would probably let us handle it, unless they were caught over in Britain, even the Republic of Ireland would nail you for that.

      --
      The system has failed you, don't fail yourself. --Billy Bragg
  94. Are we now what Russia was 20 years ago? by Synn · · Score: 1

    Does anyone else see the irony in Russia warning its citizens to avoid the US because we might unjustly lock them up?

    This is scary stuff people.

    1. Re:Are we now what Russia was 20 years ago? by Moridineas · · Score: 1

      The difference is between unjust actions in a democratic society (ie, US) and a communist dictaroship (ie, USSR).

      Scott

    2. Re:Are we now what Russia was 20 years ago? by jedwards · · Score: 1

      Okay, so which is worse?
      Unjust actions in a democratic society?
      Or unjust actions in communist dictatorship?

    3. Re:Are we now what Russia was 20 years ago? by Aexia · · Score: 1

      The difference is between unjust actions in a democratic society (ie, US) and a communist dictaroship (ie, USSR).

      Wasn't Putin democratically elected though? And, Bush was effectively appointed by the Supreme Court.

      [Insert your own joke about the US and USSR switching places]

    4. Re:Are we now what Russia was 20 years ago? by metachimp · · Score: 1
      Since we DO NOT LIVE in democratic society, I honestly can't say.


      Doing what Sklyarov did is as much a crime to our estato corprativo as political dissidence was to the former Soviet Union. Which is worse? I guess it's unlikely that anyone will want to execute the guy or send him to a gulag, but hey, there's always room to expand on DMCA.


      It's 2001, can we get off the "If you don't like it, go move to Russia", USA all the way rah-rah stuff now? OK, OK, we get it. The Soviet Union failed because socialism is evil, corrupt and wrong, and the US is always and forever on the side of right and justice worldwide.


      Do yourself a favor, go back to college.

      --
      The system has failed you, don't fail yourself. --Billy Bragg
    5. Re:Are we now what Russia was 20 years ago? by Moridineas · · Score: 1

      Yes, which is why I said "USSR" and not Russia.

      Scott

    6. Re:Are we now what Russia was 20 years ago? by Moridineas · · Score: 1

      Unjust actions in a communist dictatorship.

      Because invariably, the more Free a society is, the more likely it is that injustices will not go unnoticed. Unjust laws--unpopular laws--will not stand forever where people's wills are.

      If people don't like the DMCA it will fall. If the DMCA remains something that only slashdotters and other tiny tiny minority groups care about, it will stand. dunno if that's good or bad.

      Scott

  95. Re:I have a few problems - Moron by codepunk · · Score: 1

    So tell me mr. genius why are lock picks not illegal? I thought so, you have no answer, that is because you have to be caught in the actual theft and this is no different. He is in jail for producing lock picks not for using them.

    --


    Got Code?
  96. .. by Anonymous Coward · · Score: -1, Offtopic

    pzrxlhbgawshpehjnmsjozfvtdjbjgrayfjctzi
    tpdrkwocobkvhrkrpnkcdmydgrzndeqljzlceum
    lkounzbfkkjmxupabeyrjrppawgsdhoexgbqzav
    fudmpwaxcgesexvdpciwcfeaqdljgdtyyyebpos
    wxrvcyafxcvygvdvlffakfoymvllwdqddxfsjze
    bzjivrncijpoklffmryjgdpcioihdxmuptrqygr
    gktzfrqcacrxmzmswqjbtenunrdopkkifskqtwo
    jlapxnfjcddnrxnvxndvgdzqghvuelvpxwaokwy
    otqauofsmvavlxucnbfigluqflqupdnvbgfpqvt
    rfsnbbytfvqgxnwgfozbnxivsdkdwlfwavtruxt
    dgaryabnvqjtnvdidzeqeoqntaipgsoacthcmkw
    nvcpcapnwbcwtzddogjghxglllrqxamnurhfvmo
    kpjzuqqfzsraxochfrglgqldglzbvbfrcuufupq
    dbspzhaebcvtahzxreaipxlnztpcehpzqppqqws
    xclhfrskhmtyjrqtgiklhjpyokoiurgqypkptmf
    ccbaojicjldaxdzawfgiidfleqkxeqxzundmkxp
    ivvcdojpdbicnsovjmqabcpuaznszejgghapyve
    pgsyesaewxuswbhedpjuubssnliyubplemtlboj
    hzfokjeowhngynluiymdzdykmghaknzggbfzfcq
    vvovrdedxtevzosxgltffuccrtulkxxmakgwanf
    xhrrktbsjpqyhmgyqwrvjnoqgndizzrmdploqil
    roqvynxlswrslaqartmduhhcasfuqmgzuyclwcm
    eqjxkysruyuafvzrflgkxjtkcvrcqcauwltxcqa
    nwtsxjiyvakmlsoybdhqgjtnpakgkutltgbnpca
    jgpankiuvcipupekahbjudekpmbxuqrpzyeczkl
    boqjlaallhfzpbovnxriaztvrtjytbdsxdzsefx
    sqpjrnvkihbqlmsztithmhwmwydqzcelvifhguf
    bbjpbnsojkmzzootoduazozzeuojgprxnmmrlsa
    tolcdmmmkmrfjxomspriodqgusynsqnygxzhzhz
    lrcexwsncrmrepmxbdsggigzivcldgjkrxemntl
    uxtzhfjvxnfbxnslxpyllgzhvvmteknccpupurb
    wrvdumqzoltjpdadbfjnpmwmnwznwltczxncnzg
    fxnffotiemeocffgasdyigwizkbnmixuryefdah
    yctncoblxsomtgwvbpatwqiwyuniacybctywzrs
    kzxzxoekzluoealjacgoqclfsvebbmymeezaklm
    voavtisctuxbbavwjenjodlgawhogstpgdewhay
    kmctveerntqsxxrsclvelitacibtpaztzgshygi
    jmipjlgbyrljvbvlafwxfkmhcwtawohvszrcpws
    whstjxnudwfrxqpnhdqqezbboyjjyshqqyskzqk
    mhuupioflizrjoslewjxlvrpwwfofnijcteycby
    dkimryhijxijxqdtdgblwhggjwrfsimtekzxrlw
    ebndeetwiytscgkgwyrnlnnlsplksywxmqolpcw
    fkdthzsuhamyaysfqtmjjredwyazrejgeycelws
    xxhukotdjnmijrykxssgtplvneipohyjtoueasq
    lyplphpzkogqtnjzednusjxvwvfxpwivwankkwb
    huxhztppsplsrevnqphunnbftrlqgtbtughuntp
    bwzdcxrvcfsevwooqvwsfwouwfjtutpsvrsmjok
    pmvgnflistqwzpwmmawhhdqsbexrmwbofwxsyfk
    fhwwkeuqlvvviualeqfnkunreawqxppkyhmlvsu
    kthxamekburqjajcrgztqefivjlqhaopqsyzdrc
    termrhcqxabygeihvyakhemwqfycxnksswumjvw
    oclhlnzgsyimqxsootigjalhsivmbqkiscbrzvy
    ywppadhznqiisvuzixkmluskovywrfpnnyblnvt
    blrsmiujhfueuelezopaffmqawrtzxpldiyrsic
    tvfbdnumegoatsxdrwajybldpvrjrwsqywxcbsx
    cuctanoxmaqnealbkjprbgehumwsazrbkkkjepz
    smgklsbggaishwjsmixwwepqxzfiqegxqfppngn
    iedqgojnrygbdahbdkthxtyxkgxghljdnfzhaef
    rhhsysjawlfuvusgzyxftkgkitjgjpsytjtxnar
    ojphsnerzaeunqizqqosrwdjyinqfvtwvkjgghb
    dobgwtikvvsiabwuswrbjkfpevrtvervkbbqscj
    bkubzhyymlqltyoieiymuyfxykympyuxrrevqul
    ribebgbvvnsiufconhvitpzuwlwypgkpredcnqs
    prnvthgpaxwfpvadnvobbeujnkuudcsajzviopj
    wemyvmjptpbboqkszlefxmrdyqgybffaimegukw
    rmlfwjtxncabjvpizpvqqtqoohkcvknabvgbhwg
    vrdnznmtszdywtogrmuxlhaheelgbplcqmgtzoq
    esyzvsrybwflizzlvmljfvzxawhjsfyyipqnpjm
    lqzwjbwwcrtaleggjmqxeoeuowvxwfqwbjzxfnt
    yqltrxkbqzmpwlxilnwsefbtudpecuczscdeisj
    oejwzkoppdeedqudksnfbbjifogpqcfkxxmedys
    uzersxvpidsrlkqmpcxgbsfaffmkxdophhxncis
    xsbjrexrvpaeuqlusrwzhalwcedxtyyfsnlsqxr
    vokissitamyqaikfdzyzbtvpcqjhsexswxrzxmc
    mcnfsqtpkgulzsamuwrtkjopzltrntpzsalkjsk
    vronhcwmafzavedmurvjpsbdkgfkoffltpuywlz
    xzcfmozreqpzcdfeiknoiagvzvslzzicsjsgnxb
    tcrhardrmrghconfdmdldhjmccllaclmchunajv
    lalnptvyxurnapcaeavwdbvvaaqthjadcchdgqi
    wdhxfotrkowqrpexgxmtrxvmhzwstutdfewyukb
    xjeznfwxmchuqhfuzgpviofxrlbdnreyexxrxuc
    imdjwfireterkyzyflwaarhgtgycxtqqttqiwil
    qpqeqkvxdarhcocainskwlcahwdvfqhpnevwisz
    pkvkkznprzyjotkfgvwofjtkxnkwlulfgegnxtj
    dwpihozcavarjjiihywuctfpszgfcnfdddjvdpn
    txflkydwsijfxdxoagysctwelcrpmofrkzjwzos
    sjkqgaqllegtcrgnpqessraymdriuoarorgmotw
    xuowhpabkofphtlbojcqsmkcyrtsygvgkqiodae
    kvwgahplvmvfhljydvecofyhrqsaimmwpagpimw
    vvriqwotwfxusdyrvvsvfcmynuvcatpaxmfgaik
    tjrauwrazlynwwxmokgtperhrciodimidgmqpma
    zvvemcnbsxgnzhowgfuisuzmlqckhesrmgdayim
    bgdxtmiavopojcxpccdxyndegltjmzfxotwcbdb
    uwyojhwrwnenfjgscneqrimnmkqtlfgrjeemqcy
    erjbuqixqgfkmgoccozukiszhazbwsgrnazpygv
    fjgthwpyfrrunadrhphwexnvrbqqnyfiqoqnzdu
    bwgytrealdvjpxtwidfvvmuwnjfjmmzavkssamu
    nnybwwvdzyivqnozzdmymtditahnpuekmsaqjks
    wkfphqwrzbzlieqiirzunooazotxgmqyjqwjavw
    kehmebnwqvfndlfyzznshdqkumtlqlsbjsdtdzr
    cdifdsphrfkbrxmjkybrrfcqdcboyhnymdcpsnq
    bqdbusdhyubcfircwsxahihptbrbzzhotvycigl
    jcralhqvnhsixbgmfoajqmnlauvqxspmxhztifd
    jxyuswlxcjnvuhmrajgoduklaqlsxlegavaaawd
    vnhihyqntaokrjpmislbmtmyafbggtdiuabflot
    uodhbicejqwzvoznuvqhugjzynoslzlzhyuwygl
    jyzhhsyvydujsqdrwsljdamumefpuqwcatupjgh
    cxmqztvcsdlbhgukzxgpngsarqsjkbfhaxbylek
    lgybenyamhzzxebdvuhecoouloazncgxtztafsd
    djymkxaaghabiaacxicdbunryscymfnazkylxzp
    uklnqlnkcqcmwpoosobvtclqqhpvudpgpivrkhx
    kphdwddjgahkfntoewmfajfrifghfhlzufehpyf
    hwaiiqvvjvloczthmgbvabvfzftggjqwukwxuea
    giumzjqhgeieolwikfggywzdvxeigkykcmttlvx
    dmwqkiokqofegapkfgkyzhdrqnixgdiqsqzmfvy
    cxkcmctsxxdphscmmaakhbvxgcdzytmyhxqhseb
    jxfwtmdjskllbkxlycezkaokkuhlbbxvvhrlkfj
    ggmntomvtdupydkxeqakjluhsfhelhwjezgnthh
    gujogvfqbkspfbtdnyrcatfxcgsufbgeuowqbjt
    kqzxikzinlevqcfyfbpwvluftpdpoylgpdhyjbv
    nklfpjfejbwoghntpljppfnzcnppojxncfyvnaa
    vyrtghixavhwslalgvlmmowrmlssqqhconbxeov
    tresosqgbzfvetyljaqfbqqfobyngbynujrgbqf
    cueiayzvlebsoectqljkuhjahfdbzajlghxfmer
    rkrkphardeoxdeifuqnutrdcgtefsnicoehidpb
    tesmbipthzrnppwlcszbjecuviokggkmsfbmagk
    zbrurgwsoifljzoneuewnnzcbamphwmcrirkghx
    airlbceosdamacibahgtywdztamnxumbarjteif
    zkbmqwulfjyekxegljpgtenvimkvkyidvjvptsl
    qfpyxyowxntdbokakkrqqkwnxrjavcfmavmxpjs
    kwkwsuikvmapuzkmmwdnkopedrqbdvxqacflwyw
    tpubltzcjtqjokxkgdkbqqkpvtmiwrftzrbygma
    eqygoveizrctllbryqykjgqpghwochdipywlbbb
    swwceokvcdahntimujakygfrngmfsdkgfmeghsp
    cdbjvdpsmyyhakkxuhmavkcyknsbzuexjjvjssz
    mtvtrihykaksmnsvvogccsjxnvwsqqzbzeapvwo
    hjtjqrromngmqmitlrbpvzeecoblsuklnrnulnr
    mafmvmczdbakeperhxjqhwrjrlmkwzqwqmdxvkp
    epcphryltufsnkbzusbpoifixnrszazvzsspwmm
    ngxuenljyqvzcttcifwyvxnzmfsoycwowxiepcs
    gzhksltrhkfnyabhigzptfyrrkhygwlrvtbweoh
    toavxdlpsryrveqqvambvgjmahsonzalgrpomsa
    ahklnyvjcgnpotclwaagaccfhyajzowbcmmprux
    eacyojqoxormdznekwcamnuuzdojgvhdsameewm
    ydxqizorgfinbhoxbuicszgqpnifqjctoakbrlj
    vubjalxarbofdravvqlujrlbwmainkmwxgikvlo
    rrslrbljcakttoomtznxhdybflltnkfozwvyncx
    kyvrsllszyxvmwljbuuvoyckmxmkmiasijxxhwy
    btxjfpqarvusboaeqttgxrwgcwzjrkbkklvckgr
    cesnlqjidetltygpltkrrdnoqyiubuliecghtkz
    ffbrujoukwahouswemwookzcgpyhkihmllpwlqs
    nxzvijcivapbduavjzocatwymorcliztobxrcxl
    uczgfrgnubsjuhsgiqocmhlyiongogxqfutrdfa
    mbrrzufdtfscjjoirwedrqdireptwwifwhepxlx
    kasyaecjwsnhvjfhhjbfiooaaskvdshkoapveij
    czlhafhqipykypevgavqthfkteeidfcwibdahpt
    hbhqzfppabaeguyjknrnkkpvjcgfzzvfppokxga
    dkkftowuayvxaoavpoeppffhywcdrfobdzbxsjp
    oqtxjzieejmcvirrqhujyjlzkbxgoeihibqnhyj
    duomzmiqmudjoprnnvdgvuaidcfyxjbummqaban
    hwulyqltosfpwxmbdbuajjhjxtkvyiyaidrzeir
    pnnsxuamxdrmsdfvegcqvbhfszawtbvmtlxzkoc
    aftbrlxyktldrrbscygjzureeejngkpgrtrhvfi
    ttxvuzahlhtwybivcqelnfmazqvnknketrvemwj
    kdevqlzpgoneizwqlybuqnackiukjohhwwcraxc
    vchiqekpaoceybqsevkqqocbkfhacdapdrykxxw
    cahoouefhbjujtsbhizobpprxoznbxoedfdgnxs
    ybaqjxpmtzegrrletoqmipadodhywjucptvylsd
    mbzbleznrjzfhjxbuzpxxloxbsknygosfpdzxnz
    gxewlydbobphomwukfbjdbbtldttgakzjignmfd
    hzrsgeyhxtksaborrgbtuxwnszizbcrqxfdznud
    wjihvgwfevumlewqjebypbbkwkigonnovybbcxs
    aytnhhsjmlpfiicwfkttmmgpdapcmgmrwmgqnre
    dafsgqbpinypomnwqqycougcjstbuojbcjadzpq
    gubgziaxnacxrcfovarjttknzmyrqjucuxezesp
    yjckzydgeibawxfohmitnqynopyhxorohxdmxxe
    sbcthxabpcihhxpxjgbxtflgrxpwxtcrkrpanwk
    rscrtnxetjirpshuzipwrfwqzqydutgxyrnmbpk
    qnkxlqumiqkrlcxejhtkpmvawoxtyqmtfsyruuu
    pfjyjuliqdddkcabiemaoxzryjpgkflqrlkanra
    lfzuhyppsykrkcgqnfnnnenhklrqjizomiefdts
    njpjojkvkjgzsztcyyvrmgmmxewpxttayftszjh
    kqyaxptjtrcltspzpwqoyfzawyezhmrrydlgpko
    oqqsltsnifszrxqvwpsizjvseosxrouqfyortgr
    xlmdxadckyrxnicmwkjaxnswnbfzusjuimlmdoc
    xqmihepvynxqaxsxwfpxghgymumnperksehlgzj
    osrumuvttyxjtvcxglulkewkocgvdjmcahddghv
    ntyrfviphfodxcjnchchvrfdeasmsmnnqrgoitf
    qdacbaphphyknbzsumuboqrhsewglknrlmafpwp
    mvuwmuwznmkobcsmgqnqajnqopanrupatrogxxi
    cubvuyjmknmranuzbeekipedpwoxfvihuasaagz
    mmsafjerjlxtrvscgytzrovozqtitdduwjjynlg
    xnhfeexosptupdzvedurqvhxmjzotsoshxmhclw
    pdtztflopwdjkzpunazpfylpqwsxitvdyaozdvb
    iraoiuslacxehdweafnoddzgcrxrgfjolppisqn
    shsitxawefswwryjqbghdvctcwkvohalwuxrseu
    aekwdqekownlurgcgcvjaelnzgxmorengiebjoy
    fscwhixmphresbkgkcllohltrqfnjutpmmhgxbf
    tsrkjafqbmjwxpeykcinmwcwpbqeawttohnplxh
    wolswsnqadestiurrudbxcqrvcephmkjshlbzcr
    bsquwnnhxdwrinwvvyqkxapxzkxmqirpzwssart
    jneegdoyyfqxitcwtyvjzkprxckdegsissuclze
    mxaehpfacttmysfssgiwbrwzeerckgctjeajtdn
    menagkjcyisextokhxfsglnkgskxefitnyvuwrm
    poeyyqozmcvgkpvtzefzgkrcqkcthrdhtnyghpd
    ruylpugvqcnozpibnutpuzzhsxgvztvuameqadi
    eewharxhmnfhcplbtchkipuscvjpsbindsxiyru
    wmdumhmrpmrqogqmtivaqlywqwhbqpzfwazbyve
    tclejtzgwzdsdowpsrcxdtzihmwqiznoajqircy
    rwcufpvlroavcfhawnpsnksgjduvyezzyjwxkoz
    sixerjkelayiaxnleoiqqmwdegzlcdjwfwkbaqo
    jzxdzoonpfmfphrzcdjntozkwfdgwyqduegkevy
    acjknkdmsngicnhumkwpjisexhwzxzyooufbyul
    ycptnlnrrzclrtvpylzqsbyiewxlcqjaoybjuac
    oazmjkbdoruqfjncvubwhkyzbgwshfoittcdeqo
    krgsyfrbjlvhtwoyratyneevmssfbcicfpjihqi
    zhkssftbqfjvmglmaaztiqkpfjlmzdogoianllu
    pjarhdmbvdlsjzytohqmftpjhmgoynwzlzvdjbq
    hnehckrbrtwqzcfliayekadxptatscbhmkgpxag
    zlvwvfgnipdojehjavrywswwhdfskgsvmevruft
    bwfphdzzcdkjktcflvlocgpzvlelvsromvcyfwh
    cvofsqtcmatshilfrmtuecxeiqsbdkdyvixskpw
    ssauukrlqwsdfrcvkiaaoevdvtyqwsbfedscyhl
    kpepxgkuulaxvmkhijlvmczntwtfowpsdiltrkr
    uoyidptppnkbwmztyucrilowcuufceyfbvzqyto
    zlbsleldguvetqihfhgmmpgachxrtrttaobtbnn
    yeyzxukqgloqevojzttxbmmjwsyrjouvaifjdlr
    fmnmfutcmxkxpgozjfndmugzshlctsorwxhtmto
    nnswreyqwjeyruzjxtlbyrtoupasgfiezhnabhm
    lkbzbxbvopyymwdndxvodwsqpvukcoyqgqcbtss
    uvdpqoknqogoqydvjhuqqpilubwliwesauxmoan
    geojndxdryiswomvxrcoloqqkjcwlvigdmegwkq
    clfrlnpbviqwskfunazpmlkhkdndkwgzmrnnaoz
    gwqerzbtcsmxfeyvgzeqstrszmpzubexspihxvh
    jpqxawduurwenmwhfsuzhhbacpqarueyyihogkj
    uhxtywvutcrbbzerilvrszkthjlaiijmjxihfsl
    yozsavfvheooblsigyeuvgcmiurxlydvqsoasze
    pjkqblfokwkoafrcgqkshyqkvvornydcvrkvdkn
    htxeesoavnkmxslaynxnmqqbceynksqwiyjzyhg
    aebmghqnjxmwdjcmsptgolnlqtekyuwvockcufn
    hitpgrpvplwwrweaswrvmceqvomphfkrjnleyni
    kaorxvmxapcurdxrlyahxvicqofmltnvfuhodge
    asqpzqjyrijgefrityxzpizsrerngjjlpusfgae
    afgbepkouskhmunerzithkrjcsxsamlzvzceowe
    tauuzjkzqakbehsglgxiqpydrpxmqdgdefwafrx
    bjxbvrdicbrvuveccdazxzdsbgnpbdsejsznaaa
    rlezwvummkmakqexikrkainqbpwwjgrgaoqdvox
    expcfbjfjziecxpsgnlcogqvskdnxbccdwfhrbb
    ykntadikoklegsjasgxxhcaquqizvidpizmogjp
    wmfhryhcaolcyvtgjdcqjabfqlzpoapulnpofrx
    maixdybcjqxjlckzimtrdlrgugjqxcubdjsyzad
    xzisddydrtyviavyxzgxrhxkbcgzuskmlilzfpb
    jzpaknwrjgbffdjfmvcdwyptdsjegvmrkwenipd
    utscgfqqqhtjnmiwtamlahkuncuxucuoadcqanx
    bpwxmjbzrovgeufvjpqcyjruavbkejkxvigbgrh
    dxmozuvzwljmrmorvwiorttbrvakkpjysafthca
    kzciuqvmrksnqmecoqgckyrgivcdlsavwdhvicj
    fcdyvducpqgojtzqfqkjsqrnzagjgajptkaqoea
    svgurbmpannowuyxtakiueiuaxvbjjpnbysawhz
    fhpbwclrfpowpdydpueaimxhpqqpqsbvomjfuhr
    bqsqizlqtmighvnkyupskxvnbgxhqdxhdbiphuo
    mraxwhzgbtudunxntjdhpmzlvzdcrgzgsckzyyb
    qbgqmawrahzxhpxgvhvjzzzjocvkyssitfazvie
    dxaxgdayrswbprnyntobphynoxzucgdzxxtrhkz
    iemqukagmfvtbejozyyfdpsrmkdntmhzqlojszp
    mmfhikufypirozkxkipvgoflwowbpuvgcrxcvmo
    evlnekbxtabalzjbopdqbyiuqhmxddxsbhaogde
    xhkpojuviujberbqbypylxnczfcikzxctidrdcy
    bcbfxvynpnbnmdorhkanuzwwwwjyllasmkkngcr
    kottoqsmitvacnfplktdphxensocuahnmtrjaeq
    lrfvfdvbqmgouphwjshmpaksdaiydzjqvbepmmm
    dangruzrwgxedacvxynayfiufpyrstfjuknwntu
    uupvtmnmzifnbzxscpwaevayrixunasrhfmytlk
    ouugfossrsudhxfvlkrqiezfxajvabfyqyzglzm
    daneygwuzcsqzsrwdmpiuorxjmimuinozfkkzyz
    pywtidvwigqzqosxrgczdwqegresohrcshbklkc
    jjxrtjqsrjnbripexsmqyrfkeiemsbbgijmsasa
    iizfccqnklaukprnqtgcddjktrmxxbjpcsdhrlb
    awacawlbuyknhjnvligouufburnqkdeqeiqewnb
    nnydmucbrqogaorsjleeikuaepwwutjfcjszqsn
    hhaxbjhllekoiaxoqhyrxsyepletrnqyhavxozk
    tpmabxlbgzqheluidsuzvqiqlklfcyyxbjhqbij
    gmqoeosqtuvhwbvqmztjbzvsnpwxrorwiegshmk
    oasgjfmpiwdrrxduvqjgfawnqhacwulxxqyixdp
    toohldtlpekeuiztbwidcnygrubveobdxjaglmd
    tbsvjharxkyosilkdlbhqhnjiagfcpcrywpraro
    jsgycnzzfaouasbjmtsvatgcgaeqndinnskbmrm
    midhknmbebabgoprrahckyjekpejaujlsrwhmsj
    acjckltnkcwksbfnfrdbparsnwwozrgeixbwnam
    mmgvmdppexujxdirnqrmoacmqyfwitpowmqixvj
    bdczroaidxlzijbobjoxiikjwmxtpnhekydnuae
    ksntlfmzalxabocaqvaaekxkghojaoqwsbowgwn
    vgpnmvdzsdygciqrerjhyjmrqghvabheaizlgmc
    ebwrbbfttcxzbdeutkunnshraenpcuywauvrqtt
    ekwkralcjuaeeehdkxeeaqmfhtbqrdrihokjgcs
    zfvurgpuzpgrrlhoyheisqlddqkclswozzxmpcp
    ckgvgyggnhlcibijgbebbnyafwgzqsvckncnzkr
    tgjddxldxdgzrjgczxjixzbtnkgtgmrlzrnelhr
    kqlxuaijcwadkngdogsojzxtdonqxmuxsytixek
    eszjbqawmxsucsxlxjzsfnjicfwyqyxfmleqdjk
    okcdqkymwdyvthtwfgoezjyirzxsdbtxfnafekp
    adhzbfrzdyotckoxjzvkgsyovfjsqplvuyjtnpr
    kxioyryqlyxebfyixgzjvfymcplptpigoaseeps
    jkyfzghuigzfxfivyusbdfjipmogkheefcxwvmc
    uvlwfvmzfsqfzmujhwkjpjaxruvkzbodjigwauj
    atbhbieereiqzjyufpibblrvqamhafqjmzpgdwn
    hulltnwepzcjdmstkhcygugwcdigpkpwefsbben
    xgoievvjezcvxhzzcasbnctuebsaewkdmywamfe
    gmgcleoefjrcavqudumwxfoipgunxngapmtnnll
    efkjakkciakvtfrngofzwtfostrhjqmfoagdzwq
    vsllhdlwkgztdjkggcjuxhcbhtkgrrwkrfuqgty
    vuzucquvvookuenvptjmuisylksbynitqsejztk
    emkfuxcfjrzfjekkwzslhrggioqpxwjlrjinygm
    gdsavzhlmpbdjaefsinyrrvppvfknjvakvhyikq
    mgusrrgcuzewvvdkreatsygyffrzeujkywtsdxs
    tqifwigmkizdsegntajhcvlqqpxrdpcrffnphfn
    tapcjcpylapjozxddginzwgfigwfkotowqwrkio
    qwdybojcbjvbkiuouzrbumbkrfmnizpyvqvteli
    icmukjpdmnninjodynjgohtmqflopfafwoefhsi
    nmklfzibjayprblikswlkodkzdtvrdxtwdpiusc
    szutuyalbsjomkrcomncbnzqkrrefyqmkhnwmvt
    qgcxtmuwueqavfpiasprabkayvswszmbjcpgajn
    suspmgxbnwlvqdvyqhrqrfwpgwudhzfukxnzmoy
    vauljtanunlbbstarjnpvktkphtfujygtrgjhpj
    kyrssempihseumybfaeopgviuyegljlcrvgydrj
    jbyuamxsebaccorclmemxsrcrnoyrkpzypzblgi
    fmvwbqxddgjpallesswmapcnapboiiybjipzjvo
    ewlzahneqnzvbunmqubvhwhaowxgurlxodedjmu
    lncuwmtuaxokbeibughqiatpwnipfzdhjqbvarl
    rwdpbpburffkngfckdqznqmgifdaljuehujbvjc
    ruciicetrrqermcmaschpocdzyummoyqzymxvyi
    psknleakttwnxwlzyscebhwhdlznvitkqydtmxn
    vdcgwxufdsnpkkifhufflqbynizrhqvwkuvqpwx
    apbaxugkicaqjnkzdgkftazzczxfhxgadquuhoq
    frimhzlerzlilwjshmmhornhoarzbgpacfakkbd
    hdwirugnufoduhpjrixumnaodsoophcnxdqembz
    pjogphfbtkrhxmbbgbqrqrwgmrfeqwdxkrurfvu
    lfssegsojtjkiyudvpfrjlpebefgfiazavmgers
    zsrrnfblzeutfsczsiuiwuoiarlkdyzhimvjghg
    bynljoqauyrxysnrxyyxpwuckpguwrvwljnxjxf
    xdhymdmsxraabbkautmvfacrdshjeqkltlguzqe
    gmmzqbjpbaazrbozsqpprwwuhgokghfrpitjfbw
    fkaqgycdmgtuykazsnqalneobhjeesxzzmvfnej
    qqgcdhfuusvadthmusygmrkanintcdvmqpnobha
    wpsxafiubbasttaldcekfebfzfgzvvmwlmzikfm
    lrsoofdrdqdgwnkgzawgzzjlcivgmbouajjwfxh
    syxtfgagcnsuwqqcdbjuewlfytjbyeaxplvsrkj
    utqkgsvxfttcrubtpnghljnmvbfnoqjeljcbqwn
    kqpqpfsumemrzattcsckqjpisqevwqjrizaoqma
    dfgyphruploefoalwktvibctgnypjcbpvoqqemh
    iudtknsnhiqpwfmmirchxudebiaonaimbryccky
    wlzeseaslixocifguavayszzgbtlzzwsebpmuye
    ufgaesfycwnbxvamnfpzzepftswlbuqsuiarhol
    srbhgzoegubqpnycadfwjtwlgbafdeoziltziiz
    yquyvbjwatdnqkznjpsyzkrlqrhjmecomsugofr
    cyxrhdrenmxmhnozjjzvhjmrvjsgjhibjxtroux
    htmahlsfnshgdijgdpgqrxargqaxvkjmjwmugzl
    qozuufpniklrgrprqmgeaynkluybhsehzqsctie
    pkzfgmcrpdqdswdeymdsxoyjtmgysyrwqmcgkrk
    qzkcannqaafcyxqbhuzfqxkeleeedbybvpbqbso
    kdogfdndcppoyqpbckbnwowclumtioweromeeud
    meqxdyydpijnhvlowbhcdjjbskdzhsqilnokduv
    iwxpgvhalsraxdvvoorouznjidrfuscwfdvklth
    tuorhndfubxidhudsnguclnvuzfjwukhnvxvlbe
    bwuuqjevzzblgjfivdyrppnybavvwlriacxnzqg
    jmqshguzajfaobslzkapggvibzqsciafkqcqnli
    paqywvtvswojsvxbcgmuxytmozjrwciibcabdte
    jwvfnkghyyweljtxdlyntlwmqlftnbtkvsnqegl
    nonkswgzydimbgjxuxjuwskpcymiguhibxfcjgc
    byupfuhbcrincwvmduczedqdifocsfdseiebefp
    mjqgwcvobxzwrsxwyshoypmrhwllckgeftrjzhy
    ljcspalxtbidfcnxcjoixknajwefhgylfxivfxv
    npomrcrovyhilnspfojeklpjruhyszzopesdqai
    pzpngtanhjsexirlgfeimzfmvntbaqhaycrfubz
    osukkcmtcuglagledhuwqtaqjvhqbsijawhbodt
    bkkajhsnuchnhrpiydzcanawszhcqzebiyeuzmb
    mtkwhdruqbcduwtfctofyrhdqwlufykjblatbzs
    oigxudzydanxzuygbvwzdppufzefghxamplvxmx
    ljbxqrvmpdiycbciiajebqmxzesngbtehosoyof
    tuttlgedzguuxermajyqakwfqyckfoxqwfuaksv
    keysewxlgzlqauijbwyrmikgsrzpgkxkbtngpjk
    sbjvmvnbdhjsgxqfkanozjwmndcaqceofzjoiyu
    ysuocirkyhdhjsssrwzjzdqslhkncrksefhafuc
    lqmxlrswclcvdmxlgecmujjmudrgqfnuxjsgrrv
    catbcgjkkgljadyruimmtelnjknjrcvjgnxsxlg
    jyfezljhetzytgxhmiqadalkbollfhktzytvxlz
    abjjissbulybjqgwjagfdocoanynbbrrpjhxuza
    tcejcuxrzdsvfykgasivtnsjygtaeejegqvzsdm
    mqvvdpkamattnhvegriztlralbsaawvawwqttli
    bckjmyzwjrrzuzzigksenoeilqprjlfebpuwqam
    getozbpnnmzoixcxvmkesyrxqvulnsiarhjwivz
    ynnfmuwpvhlnpzeehqfznapifadetuopyamwsbt
    xzzcphjgxcwwttkvpzixwsftqqkbqzzeicdnxmj
    nywtdngvhgxkjgysfuvxrnpcehnbjabtqliwkop
    jpokfeszvxmjwtsafzypwtkojyeiwjwgzzcjbgz
    yeidtfuoprcimndcxhdghltgqidkkhuqguborvl
    sabvjhfegymovsjnmffiscukqctmdlnxrcvxerd
    ksnyelkxbmiqvdbxvcuphrdzugbwkobbloxhagv
    vtzccjvefplkwxjkllxvtcgoevtpsuejnnahwyl
    upxwtwloefdegtutiuclalczygizrjalwqtbxyx
    jmbowaiykvuswhfldwadpnsnbgbblnqepvhbkay
    foddhnhbfqylnudgixipaotgjbhckkpfpebloyw
    fjabfxkkvqqyvnxibpapjbjibouzfmpazrqscsp
    oltgejhwbbovtcteszddrstblemmeaajwmfcwdj
    maosllhiypcsvaxmxbavgmnodneucuwbrsotrcg
    hvtdlmqxkivbxsxcmhbwvnhmtraxbuymjffpble
    rlwushxclohzhtrqscmtgkdjojdgfpvqkjvpdza
    hgrhoolxkwetujlhiigyhtcspgsusqoyaurmpao
    hcivtblakbhimaskjtvoimcbczvpnygadzwiwjg
    pwqimuptmauabfgeuhsrvtxzhsqoymnplclaizn
    eexfoubwyxufcblivvtktnhpdewujktenifvdrg
    svesabjmmrdzvxccgwgpgycgyfpvhmvedysdnmx
    ayxrfaqgxslvzmxrehykkfhjquedclvscjmoebg
    wzkaojrrdmrkurahlkdeayodkyzrucdshhwrgov
    nzwldipcynlfwmtenlxcgtqxvfjrnsapdsvsaqu
    akpzaxmkeocavjgujwmuvouauohwsfbaxklfykt
    gyplukfmabdgbjgsoixxdhwapcnngfmgvlbziuh
    lkchspffspgiywdfbaxzdeothzkyumsyqdxgcyn
    gutikrtkttumnurycrytbahuiurcwqxwcnxgdsh
    slpdetlpbyuetplpcfunqvibgpmqmqirielgcwx
    gkjyvqueoatfjfosbzvojdbyxbwytmtxlbtpurm
    qtknylrvwsatfhzljznnsqivculperbqgaetgpb
    yfwponlvqgxccqqbrlhqkvkyltglthawjfacjrh
    jmglqvuevixllilckctibapmgvbwaybiuvxrowb
    pliqjphlswdbkahmjyoaiwqddiggdhenavthqqj
    pndjlcdhtkyvnbnzhzshwjtylvnvklfdlordssx
    jmdjsioieahehjqcwmmlvuqvvdqmxceazbcsywk
    asmygnmyyyjboxfsxwuechpldgiaymwttphbiou
    kylielrpojtyhuthuclrddhukicjampvhohdpnw
    nhqrcnbevkazlzukmftkishuinnzandsvdkbqab
    ezzwubllfzmwfxycmuacsuzpkgchujlxtdrhevm
    ghlfrconxdehcreudrcmlkprrjupoumngvkfviw
    ewcpoknssxcydmzwzsrwrcenwngkhuchrlznccu
    rtzmrqxxrrrfabexcasusngoqggxjcedjpofxrf
    fkhckbvbkzffscetrrapkghtwrcjoihvpqbumos
    yxykrhbfwrulkvmfuuzljitvteluhtbnqcdnqtg
    ilsaezhlkqtegbgqwtsezkregatohhoqgjyawkt
    motphtgjnppteuanfcgomhzbqsqkghkzvkshdwu
    neptnjybkiqahfwtzbdpgnpaqmbyecolkgvndoc
    csehzimosrywifururdsiswzpfppsrhuzmyuwka
    yiaiasdvrotkjwcdsytwgrornrbyjcfqapyetdk
    osmuezincdfreumdhjpebchzzliazzfzsisfjyc
    lnhevclfnnuftimkwcmusvqjvsfveuaatthsewu
    gfxmwzpolyitfblqdtdwhzncficwflkacvgixwe
    dtkcwaywvbibhtustbhmsokbupghmqibueudzlv
    tiajxymsjkieybhrbdyadrqtqrgebxlryisudim
    bgdbrlzeksdigddliuqhgpcplznnxfpumzzfftm
    rlagdefbydukctccelbnrqdtvpcaxcbzxqhthgl
    dsruqfhdxmcjoakwniyhlkzrmsrskjwslktfamp
    asgybtxavewtfuymdikmgnspavnkavvkrtseuai
    oavudefrrrwdgcvdmbrgismjvggyxtpibtlazhd
    npdmxqjldjqgpegktzudfkpbwawmcnpubewklbn
    flmeumhbpjrdcnvlsamcnhkkavghbsmxnrxrrko
    oohumweljzfauzkpcmkvypjglgctqtgabuywzth
    lezayftzeqsjbkenqfuacxzerwtdyzlooanzzea
    towrcusyyhjxsgxsaapswnfodcqgjimpwykxelx
    kpuovtxfwutukdwuxttapxnibvapugdhimkaono
    ahesivrrkuqtshdhjpvlgkuzatsqowqubguxxwf
    jcftkhwxepahtycszpdspuhwdqzcamudusprqoc
    jhnigetcjhtdxtcoycxwbtlfgtnrzfmflptxyjf
    vjlvbohcbonwzpjplhymlcokwmptesxdpdlftmu
    slrvgwdasotzitkwxsaegmfrgmjgegucyfykscb
    ghhixmbhppickbtmtgbnwpkvnyjkxnquqsffgbj
    iymmfhjrcffofvygyofteqyajtfddshmwkksaqb
    knsypahspwknxbftkfaoaxvaxtpwxuctxyfycky
    qtukjzstdnfrmsjnmiybdbnjhhbbexwwamfmuso
    wjdiyutabkbpaoajgkjjkodacxscubztdqalath
    oixltzetcufarxebcttmbkbgisqsofauzvlmycb
    cfghdphughjvtronfuyfimcjclugycwfvzpsnso
    eslpruemgacysrzruggusgshkclcawgnjbhkgwj
    mrfifxaefdqcndvbjtxlrcujdwsidjnchvaeasb
    ytuvdmumodpqojqbsooiplwyyciwhmkrdpirese
    zvduzspoqlbtaykghikxpjzhfjciulpraezzvjv
    pzfndfnoyuspdnodzbwcylavhmfrqhpswixjngv
    qlqvfggmtvctzsprndsmkmkqztzkugnyyyrsbbb
    rfxwyawkkyqkhasgfrmclxtlxhvlboymtwxxgpo
    ilwrqedgigavtprbmddxyuxcectgojvhdviodzu
    clnybuolbeiwnznepthyqsqtyvitcoowbvheisk
    pvqldpyeubnjbuihimibxbbpbtyeiswajyqvznu
    eacrmnsduycaikkynkbyszfbipdixiettnavqpm
    mimeqzeeqplwiqgzykeslbhwvndnmypzghblzna
    hkmoumalwumsevqqbsihtrqutimdnrbfrdtopib
    vqivlfktlrbedahqmkeahryxdzqdjmlipowdmrj
    kxlpasmezxogwsytdrzzwmbaqezkkxrwngggfbz
    vszyeucoefhjwtlebqkgfhyqkssmgbunlqnvhqp
    rmronowvewqavygkhtunaoejwgvblyyngrgihsq
    nbsgaylwwxcshaqwzqqoodqnfncvrzfjkaqybav
    vnqidfnlnqfjflositqctxwkfhhxadggtocalmg
    borwclhfhdloyjanecjikyuuzbdeysqwhogqoey
    jaaappxofegzbcmqjqjmifcwcrzxzyaumpallwi
    zepjvbjrngxcwjmykuogldinnbmetneetflotmk
    ijkzhiwdrkiouhdzjiwiwjuyxiublmfqjuuztxu
    zeapatodnzemdataniziyzxzrgxtwppjczgshjj
    opjlsxceufrqcozudmkgppopvpwwmfxilqbcffo
    uocnobhbaphnnomwlotezzmuwsxelufqedwjtsx
    nozmtkunzfeuaextohvifomcifmdeotzxkpxvab
    awdqebfbypmmtxltjeheeepgfvrtwkhkswjqjzw
    aohvqxqesueqkcpbpiaxkedwvuujdldfkgamarr
    jwhgjadhqljrivftlztgrpxbjxkmjrufbtrcqaj
    xilkjenaroaxrevyixotszmkljqwbcxzrealzgc
    Important Stuff:

    Please try to keep posts on topic.
    Try to reply to other people comments instead of starting new threads.
    Read other people's messages before posting your own to avoid simply duplicating what has already been said.
    Use a clear subject that describes what your message is about.
    Offtopic, Inflammatory, Inappropriate, Illegal, or Offensive comments might be moderated. (You can read everything, even moderated posts, by adjusting your threshold on the User Preferences Page)

  97. A key that doesn't let you fair-use the work. by yerricde · · Score: 1

    Sklyarov isn't a citizen.

    Of the United States, true, but he is still a citizen of the planet Earth and of the human race.

    Text-to-speech is offered by the Adobe software, and backups/archiving can happen in encrypted form. If you know of one good reason why you should be able to decrypt ebooks without having a valid key from the authors, let me know.

    Except you do have a valid key; you got it when you licensed the eBook. Adobe's software just doesn't let you use key to fair-use your validly licensed copies.

    --
    Will I retire or break 10K?
    1. Re:A key that doesn't let you fair-use the work. by Anonymous Coward · · Score: 0

      Specifically what fair use rights are you talking about? Congress hasn't extended first sale, etc to "e-books." If you're citing a small chunk of text you can write it down or take a picture, IDGAF.

    2. Re:A key that doesn't let you fair-use the work. by Kenyaman · · Score: 1

      Fair use is entrenched in the concepts behind copyright. It's a concept which makes copyright good for society and not a special protection for the authors of a work.

    3. Re:A key that doesn't let you fair-use the work. by einhverfr · · Score: 2

      Fair use is entrenched in the concepts behind copyright. It's a concept which makes copyright good for society and not a special protection for the authors of a work.

      Of course Adobe, RIAA, MPAA, etc. will argue that copyright is their special protection as publishers and facilitators for publishers... These companies do not believe that copyright is supposed to be good for society except in an economic sense.

      --

      LedgerSMB: Open source Accounting/ERP
    4. Re:A key that doesn't let you fair-use the work. by Anonymous Coward · · Score: -1, Troll

      Let's all be vigilantes. By decrypting stuff that doesn't belong to us, we're acting for the good of society. People are too dumb to understand legal concepts like fair use, but we can because we can program, so we must break laws explicitly put in place to prevent our actions.

    5. Re:A key that doesn't let you fair-use the work. by Anonymous Coward · · Score: 0

      Once again, if you've obtained a key legally, you can decrypt the eBook. Name one valid, legal fair use right you should have without the key.

    6. Re:A key that doesn't let you fair-use the work. by Kenyaman · · Score: 1

      Suppose I want to put the book (or whatever) on my palmtop that doesn't have their decryption program. I have the key, and fair use says I can do that, but DMCA says I can't. That is the issue. Similarly, suppose I upgrade to Windows Wince (XP) and there isn't a Windows Wince reader. Fair uses says I should be able to extract the work to an unencrypted form so I can do that. Not a use without a key, agreed, but I would argue that's not the point.

  98. This is exceedingly humiliating. by JeremyYoung · · Score: 5, Insightful

    My country has humiliated me. My country, the United States, has deeply embarassed me. How is it that the country that stood for freedom of speech has now gone so low as to begin warping laws that it's citizens granted artists to restrict civil rights? Worse yet, we're not restricting the civil rights of our own citizens, WE'RE RESTRICTING THE CIVIL RIGHTS OF CITIZENS FROM COUNTRIES WHOM WE ENCOURAGED TO EMBRACE FREE SPEECH. In fact, we're doing such a good job of it, that now Russia is warning it's citizens not to travel to our country, just like our country constantly warns us not to travel to China.

    This is exceedingly humiliating and depressing. It was less than 15 years ago that we encouraged Gobachev to tear down the wall, to enact change in a totalitarian regime that completely restricted freedom of speech.Now that same country is warning it's citizens against our lack of freedoms.

    Words fail.

    --

    Go Lakers!

    1. Re:This is exceedingly humiliating. by Xerithane · · Score: 4, Interesting
      For what it counts, this sentiment is sadly shared by myself. I do not understand how so easily consumers have lost their voice to corporations, and the masses. It's sadly growing into a nebulous entity no longer controlled by the government, a government established by the people for the people.


      I have paid my taxes, and my dues. I'm strongly considering re-rooting myself into a true free economy and country. I know nothing is perfect, but there are many countries that are much better than what we're finding here. I try to relate this to the automobile industry, and the rail road industry. It takes a while for thought transition to change. For individuals to accept the new innovation into daily life and then a balance will occur. Unfortunately, through all those "revolutions" we have kept our speech. Here, we have lost our voice. Our freedom of speech has been abolished and placed into the hands of other individuals, not appointed by state, to determine what is ok to say.


      I feel useless to change this, but I will never stop protesting. I'll never stop sending emails to everyone I know. I believe in freedom, sadly enough I don't believe in America anymore.

      --
      Dacels Jewelers can't be trusted.
    2. Re:This is exceedingly humiliating. by Anonymous Coward · · Score: 0

      Where would you move?

      As a European, I am saddened to see that the US policy of "exporting" its laws and getting others to pass them (this is why marijuana is illegal in most countries, BTW) is once again succeeding. We have no DMCA, yet, but it looks like it's only a matter of time.

      I hope you Americans manage to get rid of the DMCA ASAP so we don't end up with something similar.

    3. Re:This is exceedingly humiliating. by Anonymous Coward · · Score: 0

      And it was not 50 years before that McCarthy forever tainted American culture with his relentless anti-communism ("anti-american") campaigns (the "damn commie" mentality is STILL evident even today on /.). Or that institutionalised racism was still a fact. Or that book banning was common (and in fact still occurs). And before that was slavery. And less than 100 years ago women still could not vote. And lets not forget that "prohibition" thing, or the entire category of consentual crimes, or that it is still illegal to be homosexual in dozens of states in the USA, or FBI carnivore system etc.

      In spite of what most of us seem to think of the USA ("leader of the free world", "champion of human rights", blah blah), in reality we do not have a very good human rights record. The USA has never been very good at human rights. Granted, it has in general been steadily improving, but there has never been a substantial period in the history of the USA where there were not widespread human rights violations. The USA's general (inflated) perception of its own freedoms does not seem to correlate all that well with the reality. Although the 90's was probably the most "free" period the USA has ever seen, it seems to have gone down a bit again. Hopefully the "checks and balances" will kick in sometime soon, leaving hopefully relatively few innocent victims in its wake (e.g. Dmitry).

      I'm not saying the USA is really bad on human rights, compared to many other countries (e.g. China) its not. I'm just saying that we are also not quite as free as we so loudly and continually proclaim to be.

    4. Re:This is exceedingly humiliating. by VeryInky · · Score: 1

      I do not understand how so easily consumers have lost their voice to corporations, and the masses. It's sadly growing into a nebulous entity no longer controlled by the government, a government established by the people for the people.

      Because they are consumers, an end to an economic system, and not citizens of a country. The people who inhabit the united states are'nt refered to as "citizens" anymore, which would imply that they had rights, just "consumer" class economic units. Designed and bred to accept whatever they're told by the media and buy what they see in advertising.

      It's all very efficient. That's why it will happen. A citizen is irrelevant since economic decisions are done for the corporation's sake. Voteing is irrelevant since whoever wins will be indepted to whatever paid for the election. So why bother calling people citizens if it's an empty title? Consumers is a far more accurate title.

      -Me

    5. Re:This is exceedingly humiliating. by supruzr · · Score: 1

      You don't understand how consumers have lost their voice? You know just as well as most of the rest of us. You just insist on giving people the benefit of the doubt. The few that care are eclipsed by the many that don't. Apathy is spreading like a disease, and has been for as many years as I care to recall. I share all these sentiments, and I don't care to believe where events like this begin to point.

      I'm under the impression that legislators really don't understand the nature of this danger. They won't begin to see it until it affects their interests in a way they can't ignore or tolerate. There's a major lack of tact with technology issues in Congress. I don't think many people understand that opposing the DMCA is not the same as giving consent to dismantle all copyright law. The clarification needs to be made, but most of the people who understand don't have a soapbox to stand on.

    6. Re:This is exceedingly humiliating. by Xerithane · · Score: 2
      A definitely good and valid point. I was explaining the dangers of the DMCA to a friend and she asked why it was a problem. The screaming negative is she is a junior engineer.


      I fear by the time congress and the masses understand the repercussions of the DMCA and other related laws it will be too late, as we've already given the corporate bodies too much power.


      It's a sad state in which corporations get more freedoms than an individual.

      --
      Dacels Jewelers can't be trusted.
  99. yo by Anonymous Coward · · Score: -1, Offtopic

    oytnklbxgtoliogyf
    czadtrtzesowbndzk
    lylwdhtprdqpzuyac
    sdqlhbpobvzcplzvv
    lgjkshliyiinumgdo
    asxpkamcyvvceevbi
    qwctgkljsjpyuyqgk
    onwioyavdfqghlpwk
    suoyikreyxapaftpb
    jefhrvhhmewgkbavh
    rgxzufgaahapqlyib
    kxizzrlohdmnnhzcf
    vhinnxfkdbuaenfkm
    molozwfdgauprcmfu
    dvotuvytkiegmrihg
    zlesxcuhzgugengfi
    qpidqvtaoptkfgval
    ltnjtbtjekroqiphl
    gpcsdftihfrooeztg
    kukuuowqtnhrkwrks
    wveclavyhatoovhry
    mtywdtfgujhdaskky
    eotiitereiqorrkkv
    xiibxuwhrdeyfjxxr
    fwcnshxzthykxbyhb
    ggwjgbahmysbgyrnn
    sjsxthfbvjwoqtpkc
    zzwycxhplnjhavfwa
    fcfxyoubxucwjsvtm
    disymvjbelmuiranm
    xqmwjaldlwrssmdsd
    idrcklforpxwhnxjd
    dgklmbafhfaiejqzq
    fbuzzozvkfqiqiocd
    vkzsdllfpuxnpwrxo
    bosunjvtrvnhplrcc
    oxmyinmoeukwfpilw
    syfswesaebclkzexq
    bpsalhnuipsdljjxr
    rqbxpzfabggkcmzwp
    rlteagphwxrcqqvis
    wgswsmbslyazuelab
    yvkjsrkhftqpkpcwl
    aypigxitowpnybspr
    lszhednzsfpfcyjox
    chesluhhswhmlvigc
    otiyohbcchglmbeku
    epsmrhseefasaqyum
    jofzchoxmyppxggpn
    rogfymrujyajxulgx
    lqeffjckwxxqkoiuo
    tiihlhfouadugeyfz
    dcqdjmnndfadwjnqx
    rxscpajwvshakwlng
    pnymicphxyoqqtndu
    ybdbacmkgtxhtqgqh
    fwdhciepbljztkdjs
    gvhscnphnkejewkvj
    bqyqyqvfkbfqhoems
    wvftmadwwsbgncrst
    armouugfyvlwlairh
    gluzqnhvorwomjrep
    kpflytkclvlvfuyjc
    zhmbymqoncjgrounj
    gimishypalqrtvtus
    wyvoowkszgcazlqzh
    zuepyudeihcztykvu
    zbnykonckvwpothjg
    tyahrohjquolkgqmr
    ewjmhtdbxvddbvyfu
    tsabyqqvkuuxlwvss
    yvaszskakopfydvva
    nzufphabyclqrrssm
    yvkqlortqjasaszvw
    ymfxpnudsnfmdtdjk
    ybrwkziurqchmonsw
    ztgwowfdclxiddivg
    xkbvvcmqtiefcagww
    lelrzqvjuabnuvjhj
    qtnljgrmsqcceanwv
    rhjshnqylyvbcsvta
    vulvlbvgpkaoozxvs
    drmybtpnlsxwerqcj
    glxgahsqsvuorjwro
    bsmfjzptulgjpilfp
    vvokjclzwpvpaidor
    iwhldvzuipoqnmrwt
    fsdzijfmnlcabhzxj
    xetruyieylzagpzjk
    gexxesqarejcdebgt
    jfwslaigloixjrnxm
    ezwcibgvvtpgvacqk
    pelgzsnknpvlkkqsz
    fqigvqhtnzwotkldh
    zufoefrxivghcsqlb
    ohyuvwbxwapqtforj
    zfefgnzuzjpamocrb
    dpbvodacvuhvermyl
    xyexoyewmpznsxgdf
    igkpsuhovvnjvblzx
    chapsfjupxsywrzwn
    rltsuvwjnhulrlxst
    bsmdjqjizdollhtan
    djluhcjtdiuyzccqq
    yaojfoecvsvrvikkg
    ulvaokdbcgfncihua
    fehkpipusaojhrvkl
    hwrijvllizpybrije
    drpgcqcqhnkiztlcz
    zndbjljiipvszfsfp
    lwlvhajnxxcdjbjzl
    xwzmdpqlsqbhhjpdc
    acrdgkibjtyvuceak
    oqfnvsciihttowzzy
    mxrqqnjudupsauuje
    dkewztpcppxvqdkhm
    qelpwzvjzdnvuzofw
    osjsrsmzctyzsjveh
    segncbsakocxqaejx
    mzlbkoqhwblmtejqh
    jcgodilhixlpdlmem
    vyytgfqxwrhacfkcy
    gohrmnvrsdqlymcqp
    udantqjaulepfsqqd
    edorakdklfoxwpuea
    eplkzgmeslivxuiei
    znbiiksquxsxcgaxr
    giokpgqxvkkouswoy
    mwnpirugslqchtdfv
    sklwoxtanibwaahil
    ripletzuzdqienlgu
    tchfplksbzgemzmoa
    jbhsajhnmsmuqlfyh
    qyaraymfdlwbcmdwy
    goozoipnflmwfzups
    odliwillxrxbyyyhp
    ldwrlmcvvioeeqlod
    rbzvkbltpveqabcys
    cugtntwcdepdlziql
    sqoytvpngfsewhgfz
    ddmalkfzfsgvnqqqb
    yakzeiateyukgfcwd
    rfdchnsqgjeuylivl
    jtpcysdmcajwjydww
    zopcigtipgyaykkbi
    oauqooutqorfpfjyl
    qndloybfghrphomrj
    rdbxalvzdmktrpquf
    dolxfptqtycowzhfz
    omhuxpsdljzrcjbki
    slnexamgjhuquvdkh
    rkgwbfqbslhdnmcyz
    ykcljlworijmhuavt
    gqzscstzhlzlkhzyh
    yavtyofolcjddckqi
    vqnsiyvijwmhuchcp
    kjpzjyyoqimecfmrg
    xgfcyvftcpzbybtbe
    zsytrdwtgxkpgcgkw
    gqwiagvzydndgstzb
    tpwawtkutfnjxjwfd
    endqaaooqkbvlqqnh
    lhmxnpsmtdjwyligg
    qngyasgrxdphcaxwb
    vhzwazlyohnudgfkl
    yceaszwkekiphdacg
    dekhejcqumzxyivfh
    qzcgijslupoobtzau
    pstfrmnssxarvrjtr
    ojgyjbsoxmxtfkqnu
    zftmbqxoekzmtmbdj
    sqhsuijkrhlibjpjw
    usjgpxddharpfqsnr
    jnfhvfklflewvmdge
    viilrpwxcnhuxrinu
    uqvlbsauvjcroawgn
    ovvrtvpohbqppwkly
    mgupsrjgqnhrvskas
    rcwjqlvkfxdyneqpo
    wjjislofhhawwhgrx
    hnobdqbvzbmmueqfv
    kmzrvgcxynzgdmszd
    rmqexexquisaonfvl
    ddduzzevzvvncldxn
    webrxydishqkdaqgi
    msxkksvpyjymkkbta
    mllishelkmaubfwds
    brrnuxkhdplyvmnbc
    jrqdcsvlmblwfjokd
    ufkfesgmiwumkrols
    xtkzsjhqytjgerqqe
    zvbpzkdetsqkqfvie
    jhiujvtnehtfqzuwb
    newpatcnfuldkhzkw
    fkvelfgvrwpetfkuz
    ezjsxotgxayddpkvi
    lkpihnbpmsmcszouv
    eimztdmifjgairwhi
    txtkwdwngsiuiqzwy
    sswbffrnmxwpbcnjs
    yraggifuckatuwqap
    qyalqedhjarqybltd
    bxqzuvhitmonescfk
    lisnnzxlihuoxmlpm
    vpwvbofeimrvoifpq
    hwjecwaydlazgnrmi
    lbahwcbxyqvokicqe
    mtraozggklguyqkvs
    otxrzfyjituezelmf
    dsdyqlnravcsaapej
    gdgtlaxutsaygvkjw
    okfsskelfjjhnjxnz
    djekhohixiqzkkowb
    jdrxwopoeipwtmitm
    zrcqcvchnrgcnhmqv
    coljcoriafhefgaxr
    gzlvrynffkfcasalo
    aatzyekjoagawisag
    cqknufjfdmeqtikmo
    mlpfrsbyzapmavoqu
    veibzmarmauuqlgqu
    oosyhjqvzqomgcpqy
    niocrosnnvnjzhxid
    pqthgtqaxfvjwsrkh
    adwgcbihxtmvzewoo
    rwvflfzdvokqjpdcx
    uqsmfhhrfdykhoebb
    xhrszuvirrfffimtg
    xisixcsrgriianxtn
    hdbmnicrweliqmryf
    wxdldatsmzsuxbppb
    eawakswgupynssehn
    hzyhvvmarxyqkarpi
    jwdvkjjqyvkfyogbz
    tpvjspqszmkvtxyrb
    vievmnnuphfqfiraf
    lpsrvvgomhdanglda
    dxfcdrvxwzifbmfvv
    evwubmwpgpndubkfg
    qdvgshlxaulmhhude
    qreedzqvbktxaxhhe
    xslwqmgnaeycobyov
    xeuhgcokknqnefibf
    cicuayehowvucjgui
    zdxitmwqkdfmtotea
    msauigxwxkkrebqxx
    qwnctcgvomqhzsect
    ysygblggssvmqfpty
    rtrxglxfildzgvrno
    yhqqsipdzdllteszn
    lqonosagyjgqeissv
    bbvtfefimrnvlssfp
    dttazfzwvavaukyhh
    osuqkxbhtzdjwiikf
    jynzxkculfsosymsv
    hnunpdsagoujngtgs
    hslpybtzyxbtuntej
    rbcndwjjxktlclcmq
    wukcbhcznirivwemt
    eabtkylvevcsgqlnb
    lsvrxrlivhwlcyxll
    dhqxatwawqxtqqpiz
    tszatirawxvsqirhb
    fzkophdbmdugdzaif
    naccfepcxwnqfglui
    oamjsnlozztdmqvia
    qcxumgvndkizmibgq
    jlbzpvolzqzdmmhpt
    noiufgzqgvbmytovm
    zyuldddfzarelushv
    merkuudwbrehcvtpb
    slajpbrvdyptomzec
    ajyivnrtctwvqbweg
    tdaghpbnkfdlozadn
    zfyuebdyrasfrrnlw
    wbpmrumfczaqoskro
    wikwvopmnrdcxgfqb
    cgelxeeylirdirfqo
    ekuhmvytckjiugham
    pqfddenbyorwezemd
    ahnggxesinrcvhzsk
    xmqjiyorqvpphposs
    lqqubzhehrfethkzf
    nogtmlwqghapgiojy
    gxozxkspvuouygwsa
    satfyocohzgsrmocm
    etecvyimlrjggrdgc
    eonotbmnwoefbgthq
    dgpuckzvhyaalaxvn
    qvtlntsucbnobwimj
    rlazwnwhccpvodmip
    idkmlombmjfqkcikt
    gcgpwgpssgltpbkwi
    edcmzcykwaajsbpkl
    qtnjiqixteenjqdwq
    cazxjtvpamzforgke
    dbktezgckbtucsoyx
    lrcdvgtykupeniqca
    uykianvicobyqhnzt
    teumqiulxhbidwpou
    ecbgpstpimxpovbnp
    hiykytauuoiqfophz
    vjthlyetvhsjucjol
    gmmxilfmdnipkuixs
    kclvbgksjqimwfxok
    qxdqklmntwmblrjcu
    ieutqhrbpqwqjswdl
    ensvycnskktkvchdz
    cxbpojornnagvxbkj
    mbkjmhbmcloymnqam
    ehghxguwzpuqmmkxt
    pkfawiefstuhxlmcc
    fthuunliefmrzokhh
    iarmhdgrppqsiqzhe
    xmyuigicvlljzubey
    uznmeuvvkiyfuiphm
    ujkokdhfddisgbyvy
    ohakenhdjejvmmshk
    ubyammtyfesbwcoko
    tvwacpxvozkzocdfr
    jlbaqzfadmungreaw
    ftphkulltsjpyyeip
    vqcudppahtdjpdssd
    hrdonbxqxdgzsrgsc
    qlxhqohrxazqqwezm
    wakcezgtlwmtvhkhp
    fjcanyvjxdnsdydbv
    mkvrjcbagoymawvnq
    wniqvupjvcpnbhjtm
    rjtprqwmawcceqzzg
    keplxfsuphpgkvtbj
    ktcpqpjmshsopccuf
    oecrkgfednrjbpxqw
    klcfcftigdmdfbfay
    bdzzriueyyimixvct
    akpljqhmqziohdcmo
    kseezlfkauajsppld
    vtefyqhogvurlvdds
    mjqfimptqdvdrneep
    qasltknddrcifrtbw
    xqyooudzeitfxweym
    euoizutpknzkankuu
    ghoygxbcjlxmgsrds
    kzpflbgazrtxvuzqr
    neboxakhffoulxzlw
    pjblategicaywhqdb
    rcnaivctokgubmngx
    zyfjhdvmfilzopocy
    xfrrulmpvmgrjtoim
    izjwpvlkewpbuggaj
    xnrlcqhvucjvjovdk
    aytjcomxxjvfbkzhh
    mldadegjhqdfwprpv
    yruflprjzqrdvwdvw
    imsivmdkjpdygcnlz
    fgqxdzfxkozybxfnk
    iswjuvniwnjibjbqe
    mztcwhxtdrftsfljj
    zppyvkqmbcvebfqdk
    ttpgxqzvsclmszfqp
    creucbzxvqmxxjmta
    bxraopurylnhkupcr
    gdqybqbzzxhskpgcr
    lsoilvpkerblgcsmu
    erhzixdbdyrnlrraz
    aezcihrbvujxqwsxr
    ppgxzmpssxkatgycu
    aidilddjupaiypoqs
    wrpbbqzfjqkevlplq
    luddaydzbudesnjoz
    waokutxtqdejxmgcm
    terjahpciheheaaiw
    auieggbpizrbnddri
    efvblllturgkuyhwp
    pkmhohkvcqqefbdcb
    yvqefnzilooczgmvv
    qkxyqioczfskewywu
    ofymxxirarnbwqcsf
    eamaccvntzcsyriam
    dvccicfqmkjiwbwmm
    qcevluvroqmczxjtq
    crlmvgvhzgaeubhtt
    yfykbowdzgbclfwac
    nrhbfqeqvuvjwxcow
    aksicrqcrfniavsmb
    sbrdddmotstvoqjvt
    oarpcxdnkvaswleho
    fcyihlucnklrznhmw
    iqbvudkwgvndibzcz
    bnwszodiccnedfmnl
    sdwabdpgtdeqpmgdc
    zrghhhemftuxfjglo
    kwdnpfkoxxubsoyvx
    fsstlmyudxgywkizh
    azzsisuasndrpsanm
    pqizpemfrnqqwqwec
    zvoqrrsughqdpticr
    amcvwflfnsufkdgbz
    npensdxpofqtvsnwi
    vbhcsllkwezbmybxx
    vtdpxkbuzcqjhwkvr
    uvhwusrvzbqxjaidv
    uslunkgpximtktrww
    svgllyaprmzgbmuwt
    eyvbkxqhpsjthynqr
    cjxlejdpuzklmlcfj
    qtqcmddzjdvcaajwu
    thkcodlgbqkvzueck
    ayupstidjaqhbzzgz
    plqsydmaenwhbozfk
    ytyyjiogevvagwrvr
    zwexdgovddfrrmfdz
    ooywxdbygeudkmmuy
    ktnhtkpuczefvlgre
    uwoemtkpnlhtsikbm
    mwmvqhgfnayyaakug
    exmnhjvizpkhlwrdj
    azdjjtmpplrywtaao
    rdhjvtmijbuuhrjij
    qksvibbppwxlxqxza
    ohagpmzfqzxvtclhc
    worthpjyhznyqdmsm
    hoqafbnjdlhnbxqph
    esdvmcokqcvdlteqa
    ssdffyxmsgvjxonpo
    mwdvlvtwqzpdznyzs
    xamrerxoratnbgrvl
    wwwrqoudfmlykanwv
    uynoahbnmxqzrlhjc
    junlcltipepcrquqt
    grzeuhpkryyndubyg
    abxxrrksfxrocrfaf
    gfvfzdtkuabnhbksg
    buzaumnpysaffvqql
    qgbsdlvbducddyxbx
    xsrkadlultpbrkgqb
    hdwbeoqwqdufuyjmk
    uqmpurqqzbynbxrpw
    mdapehaqirjnykxyn
    iwxbtejunyvhhghxt
    ebykajsbqujpcvgml
    oknaptiunkqcrqxrn
    ocqjvyvwrdrynskas
    ebgdscueinlmhzqvj
    uhjtepjpjofejxenp
    yceouacqwouqufflb
    aqqlzypuvxcvjkxas
    datixgqitghvychih
    wbmgoobkozailnavv

  100. Skylarov seen on 5th and Main by Recolada · · Score: 1

    Dmitri Skylarov was seen today at 5th and Main entering a porta-potty. There is wild speculation taking place as to his expected visit. Coverage on Skylarov will resume after this bulletin on the Condit case.

  101. Coverage in Time and Newsweek too... by VValdo · · Score: 3, Informative
    It is starting to get some national coverage...aside from the NYTimes story there are also these two:

    Time Magazine
    Newsweek

    W

    --
    -------------------
    This is my SIG. There are many like it, but this one is mine.
  102. Russia is not the USA by Alien54 · · Score: 2
    the most basic part of this is trying to prosecute someone for doing something that was legal in his own country.

    The USA does not own or run Russia. So why are we trying to enforce our laws there?

    How about making Russia a full fledged member of the USA so that the US can really make them obey USA laws. Sorry, there is that small detail on democracy. They might take over the USA that way.

    What else is the US going to go after?

    y'know, Adobe should PAY for Dmitri's defense. It is only fair.

    - - -
    Radio Free Nation
    "If You have a Story, We have a Soap Box"
    - - -

    --
    "It is a greater offense to steal men's labor, than their clothes"
    1. Re:Russia is not the USA by jazman_777 · · Score: 1
      the most basic part of this is trying to prosecute someone for doing something that was legal in his own country.
      The USA does not own or run Russia. So why are we trying to enforce our laws there?


      This would logically lead to the question: so why did we bomb Yugoslavia, exactly?

      --
      Slashdot: Failed Car Analogies. Amateur Lawyering. Anecdote Battles.
    2. Re:Russia is not the USA by Anonymous Coward · · Score: 0

      We neither own nor run Colombia, but we have laws against trafficking illegal goods into the US, which is the analog of what Sklyarov and Elcomsoft are charged with on all 5 counts - not actions in Russia, but trafficking the junk to the US.

    3. Re:Russia is not the USA by Idolatre · · Score: 1

      We should boycott Adobe until they agree to pay for Dmitry's defense

    4. Re:Russia is not the USA by Silver222 · · Score: 1
      Or why are we spraying Colombia?

      --
      "It's not a war on drugs, it's a war on personal freedom. Keep that in mind at all times." Bill Hicks
    5. Re:Russia is not the USA by Alien54 · · Score: 2
      This would logically lead to the question: so why did we bomb Yugoslavia, exactly?

      and this leads to the question of what responsibilities do you have to your neighbors (as a country).

      Could you apply your laws to the actions of individuals in the other country?

      Could you say where the line is to be drawn, and when is it proper to intervene, if ever?

      And then you can discuss the individual situations in Yougoslavia, an area of the world the gave us the word 'Balkanization'

      - - -
      Radio Free Nation
      "If You have a Story, We have a Soap Box"

      --
      "It is a greater offense to steal men's labor, than their clothes"
  103. let him Rot in jail by Anonymous Coward · · Score: 0

    This guy broke the law right or wrong.

  104. The U.S. is Evil by karb · · Score: 2

    Has anybody noticed that the U.S. has the DMCA and nobody else has anything similar? (rhetorical) :)

    How about that most of the entertainment industry is based in the U.S. and/or targeted towards U.S. audiences? (Not trying to be U.S.-centric here ... there IS plenty of foreign entertainment, I just think that it is bigger here).

    Then, is it so hard to believe that the U.S. would have the most oppressive laws regarding copyright protection? Much like France and Germany have the most oppressive laws regarding Nazi's? I'm sure middle-eastern countries bend over backwards to suit oil production. (etc.)

    We still need to get rid of the DMCA :). I just dispute the idea that the U.S. is a bastion of totalitarianism because we have bad laws for understandable reasons :)

    --

    Jack Valenti and the MPAA are to technology as the Boston strangler is to the woman home alone

    1. Re:The U.S. is Evil by Sludge · · Score: 2

      You may be interested to know a version of the DMCA is coming to Canada, whether or not you think entertainment and consumerism applies up north as well.

  105. The Attorney's office broke the DMCA by cvd6262 · · Score: 3, Interesting

    From CNN:

    The U.S. Attorney's office brought charges against ElcomSoft after purchasing a copy of the software over the Internet from ElcomSoft's Web site, which is hosted in the U.S. and uses a U.S.-based payment services provider, the indictment said.

    So, the way that they knew about the crime was to commit the crime of purchasing, and thus owning "illegal" software? I guess they probably think that this is like the cop who poses as a buyer for crack on the street?

    --

    I'd rather have someone respond than be modded up.

    1. Re:The Attorney's office broke the DMCA by Natalie's+Hot+Grits · · Score: 1

      uhh, your an idiot. Drug cops purchase drugs every day to secure convictions.

      The DMCA has a provision allowing the government to not follow the DMCA rules for warrants, etc. Even if this provision was not in there, The government still would be legal in its purchase. It is called gathering evidence. Its illegal to posess drugs, certain guns, etc. Yet the police can legally do it for this purpose.

      --
      Two infinite things: your stupidity and mine. But I'm not sure about the latter. If my sig offends you, I'm sorry.
  106. No Crime, No guilt. by Penguinoflight · · Score: 1

    First, even though Sklyarov was using a US server, he isn't a US citizen, so he shouldn't be judged by US laws. But that's not really the point.

    If he plead guilty, he would be admitting that what he did was wrong, not that it was in violation of the DCMA

    --
    "And we have seen and do testify that the Father sent the Son to be the Savior of the World"
    1 John 4:14
    1. Re:No Crime, No guilt. by metachimp · · Score: 1
      That's not how it works. If you're in a country and violate their laws, you will be arrested, tried and convicted (or not) under their laws. All the US Embassy will do is give you a phone number of a lawyer who speaks English.


      I think the DMCA is awful, but realize that traveling to another country makes you subject to their laws.

      --
      The system has failed you, don't fail yourself. --Billy Bragg
  107. He was describing how to do it... by Smallest · · Score: 1

    that's all it takes to break the DMCA - simply telling someone else how to defeat a copy protection scheme.

    -c

    --
    I have discovered a truly remarkable proof which this margin is too small to contain.
  108. Beating Bullies by Fear+the+Clam · · Score: 1

    As my brother said to me the other day, "The only way to beat bullies is to stand up to them."


    As Ender would say, the only way to beat bullies is to hurt them so badly that they can never hurt you again.

  109. The software was sold in the US by flatrock · · Score: 2

    The software was sold in the us, through a US distributer. This isn't a case where no laws were broken on US soil.

    To keep with your analogy. Your person who jay-walked (created the software) in Podunk, then drove to new your and ran a red light (distributed illegal software) in New York. He got cited for running a red light, and your complaining that jay-walking isn't illegal in Podunk.

    Dimitri's writing the software in Russia may not be within the jurisdiction of the United States, but distributing that software in the US sure is.

    1. Re:The software was sold in the US by rking · · Score: 1

      No, to keep the analogy someone else acting for the first jay walker's employer ran a red light in New York, so the first person gets arrested under some bizarre sort of reverse-vicarious liability.

    2. Re:The software was sold in the US by dachshund · · Score: 2

      I wrote a book. It's legal where I live. Somebody else distributed it in a byzantine country where free speech is restricted. Who's responsible? Me, or the citizen who broke the laws of their own country?

    3. Re:The software was sold in the US by flatrock · · Score: 2

      That's assuming he had no knowledge that his employer was going to sell the software in the United States. If he knew that they were going to sell it there, or even had reason to suspect it because his employer sold there other products there, then he's responsible. Not only did he create the product, but he got paid for doing it. He even came to the US to tell people about it.

    4. Re:The software was sold in the US by flatrock · · Score: 2

      That depends on if you sold them the books, knowing that they would distribute them where it's restricted. I just don't buy the defense that he had no idea that the software would be sold in the US. I doubt the version sold in the US had it's menu's in Russian. That doesn't mean that it wasn't intended for other english speaking people, but from my experience, if you're leading a software project, you know who it's target market is. Maybe I'm wrong, but I think assuming that he didn't know it would be sold in the US may not be reasonable. I'm sure it will be brought up in court, so we'll find out more soon.

  110. Hell of a deal by buss_error · · Score: 3, Insightful

    ...When Russia has to tell it's citizens not to vist the United States because they might be thrown in jail for something they did in their own country. It's just too ironic.

    --
    Necessity is the plea for every infringement of human freedom. It is the argument of tyrants; it is the creed of slaves.
  111. No other case... by Publicus · · Score: 1

    "No other case has gotten this amount of attention," said Matthew Jacobs, a spokesman for the United States attorney for Northern California.


    Not even the OJ Simpson case? Right!!!

    If this guy is with the prosecutor maybe Dmitry will be ok after all.

    --

    My Karma was at 49, then they switched to words. All that work for nothing!

  112. Nope... by Anonymous Coward · · Score: 0

    ...the problem with the DCMA is not in its enforcement, but rather in its very existence.

    Kill it, and let the prior law, including the common law, govern.

  113. Let's get a little perspective, shall we? by ldopa1 · · Score: 2, Insightful
    First of all, the "Justice" Department doesn't carry out justice. Our "Justice" system is based on the concept of Jurisprudence, which basically means that America has taken the stance that it is better to let someone go who actually did commit a crime rather than imprison (or kill!) someone who might not have. This is why we use the terms "Guilty" and "Not-Guilty" instead of "Guilty" and "Innocent."

    "Not-Guilty" does not imply that the person did not actually commit a crime, just that the person does not fit the legal definition of "Guilty." That's exactly why O.J. Simpson is walking the street a free man today. They could not say that Orinthal J. Simpson murdered Nicole Brown Simpson and Ron Goldmann beyond any reasonable doubt.

    That said, even Sklyarov's arrest and imprisonment is definately against the grain. He is being treated at Guilty without a trial. He entered a plea of "Not-Guilty," because while he may have committed a crime, he and his legal team belive that he is not accountable to the law (under the law) for his actions. Specifically, they belive the DMCA is flawed and inherently unsupportable.

    My personal view of this should be quite obvious. For clarification purposes, I think the law is asinine. I don't think anyone has pointed out to the Justice Department that everyone who has a Web Browser (nay, a text editor, for that matter) is violating the DMCA. Section 117 of the law gives no exception for that kind of technology. The law specifically states that any computer program capable of displaying copyrighted material against the rules of the copyright is illegal. It makes no provision for the level of protection afforded. It could be argued that HTML is a form of copyright protection (i.e. META tags) as it obscures the text of the material. Furthermore, it should be pointed out that all it takes to make a copyright is to say "copyright 2001" and it's legally binding.

    From the perspective desk, think of this: I can legally obtain, sell, and distribute the components to make nitrogen tri-iodide (a highly unstable explosive, don't try this at home kids). All I need is to go to my local Osco Drug, buy some Iodine crystals, househole ammonia and coffee filters, and bingo, I've got a HIGHLY explosive chemical that requires no fuse mechanism other than a rock, BB or anything else that'll impart a kinetic shock to the material (including fingers). I cannot go to jail for that. However, I can be fined up to $500,000 and get 25 years in jail for writing:

    "UNLOCK COPYRIGHTED MATERIALS FROM SUBMITTED DOCUMENT" as soon as I write the compiler for this new language. Note, it's not illegal to write the compiler, just the words above.

    Of course, under the DMCA, slashdot will be guilty of violating the DMCA for distributing that code, and everyone reading this message will be guilty too. Just as soon as I write that compiler.....

    --
    The Dopester
    "Yes, I'm a Karma Whore, but I'm doing it to pay my way through school."
  114. WELL DUH by Moridineas · · Score: 1


    Given that programmers are about the only resource Russia can make any money off of now, is it any wonder that they don't want their programmers going to the US??

    Scott

    1. Re:WELL DUH by Anonymous Coward · · Score: 0

      only resource? think again. russia has a vast supply of natural resources, that if used to their full potential, would make russia one of the richest countries in the world.

  115. Links to Elmsoft's spamware and spam tools by 13013dobbs · · Score: 1

    http://www.mailutilities.com/aee/ - a web harvester

    http://www.mailutilities.com/adr/ - 'Direct-to-MX' spamware

    --

    No replies made to AC posts. Please log in.

  116. Can I pimp this report? by eddy · · Score: 3, Informative

    Many of the issues here are discussed in a recent report:

    M. Skala. "New Media Copyright Extensions Would Harm Canada", Aug 2001

    It is a long read for the weak, but it clear and to the point as to why "laws" such as the DMCA is a bad idea, giving a short history of copyright and a summary of recent events in the world of IP/DRM. I believe it can help people focus their arguments.

    --
    Belief is the currency of delusion.
  117. The powers of a jury (or Judge?) by kjj · · Score: 2

    I am not certain of that Sklyarov will have a jury trial but I would think that a jury or a judge would share many of the same guidelines for the determination of guilt. That being the case I would just like to point out this site. which outlines many of the powers that a jury has. Note this fourth bulleted item.

    When they believe justice requires it, jurors can refuse to apply the law. Jurors have the power to consider whether the law itself is wrong (including whether it is "unconstitutional"), or is being applied for political reasons. Is the defendant being singled out as "an example" in order to demonstrate government muscle? Were the defendant's constitutional rights violated during the arrest? Much of today's "crime wave" consists of victimless crimes--crimes against the state, or "political crimes", so if you feel that a verdict of guilty would give the government too much power, or help keep a bad law alive, just remember that you can refuse to apply any law that violates your conscience.

    By these guidelines I would say a jury (or judge) would be perfectly justified in declaring Dmitry not guilty.

  118. close minded drone.. by Anonymous Coward · · Score: 0

    i came up with a ford duplication machine that cloned my ford so i can drive to work with one and have the other for driving to the supermarket.
    of course, ford wanted me to buy another one instead of duplicating the one i own so they sued me for intellectual property duplication.

    see.. a car example is a bad idea.

  119. The state of the US government by Ulwarth · · Score: 2

    I love the United States, I really do. I think a lot of the reason why it's such a great place to live has to do with the government. But more and more I'm starting to think that it's getting seriously out of sync with modern life that I wonder if we're not headed for catastrophe.

    I'm part of a citizen's reform group that is working for change on an unrelated issue (website). But the things I see in the Skylov case are strangely similar to my group's fight: politicians that don't understand the trappings of modern life (in Skylov's case, technology), blindly make laws without consulting with what the people want, and then they afraid that they will look stupid if they back down on something they were obvious wrong about.

    What they don't seem to realize is that they look even dumber for not acknowledging that a mistake was made, that they misunderstood the situation, and that there are situations that they failed to forsee which were not fairly covered under the legislation they created.

    To a certain degree I hold the American people at fault for not being more proactively involved with their government, keeping a close eye on the things their representatives are doing. Hell, pretty much the whole purpose of the Neoteric website is to try to get people to contact their representatives. But I still think there's a failing to the entire system, something that is getting worse, and not better.

    I think we need to find a new way of doing things, and fast. Technology, and society as a whole, are changing too fast for our current government (good as it has been for the last 200 years) to keep up. And a government out of sync with its people is a dangerous thing indeed.

    1. Re:The state of the US government by metachimp · · Score: 1

      I agree, and if we're going to do it, we have to nip it in the bud, before it becomes entrenched like the War on Drugs, and then we won't be able to stop it.

      --
      The system has failed you, don't fail yourself. --Billy Bragg
  120. Re:I have a few problems - Moron by Vegeta99 · · Score: 1

    They aren't? Funny, they are. Without a license, in most states, it is illegal to own one.

  121. Re:General note to anyone reading by Anonymous Coward · · Score: 0

    You are not under any obligation to defend _YOUR_ freedom neither..
    stupid sheep!

  122. I'm afraid by Heph_Smith · · Score: 1

    Am I the only one who is mortally afraid of living in a country/world where it is against the law to test and announce security flaws? Won't this not only limit the improvement of security and give people who first learn about a security vulnerability to exploit it to its fullest extent? Especially if the maker of the product does not feel forced to fix it when notified? (We all know cases where big corporations need a big push to spend money to fix a problem)

    I would think that people who support these types of laws would fall under this list:

    Companies (trying to save money and image at cost of quality)
    People getting paid by big companies (bureaucrats + lobbyists)
    Ignorant administrators (thinking it would help protect their insecure boxes from their lack of skills and attentiveness)
    Ignorant masses

    What else?

  123. One Question by NoMoreNicksLeft · · Score: 0

    Is this even in our jurisdiction? My understanding is, that even though he wrote the code, that the actual "crime" would have been committed in Russia, where it is legal to do so. Therefore, we have no right to prosecute. The very most we could do, would be to pressure the russian goverment through political channels, if that.

  124. Re:I have a few problems (I noticed) by fobbman · · Score: 2

    "Seems to me if Skylarov was only interested in promoting better security he wouldn't have tried to sell his product. This looks to me like someone trying to make a buck off an insecure product."


    If it takes someone with a financial interest to stand up for our rights then so be it. I don't particularly care for Larry Flint but his fights for free speech affect all Americans from puritans to perverts.


    "Instead of doing that, however, I decide to market and sell keys that can break into every Ford. Now, don't you see what's wrong with that? I could have taken the high road, but instead I tried to make a buck. This is pretty much what Dmitry did."


    No he did not. He made it so that we could, to properly use your Ford analogy, loan the Ford to someone else to use for a period of time, or even sell our Ford to someone else whenever we want to without the vehicle needing to do a DNA test on the driver before it allows the owner to use it.


    The only way we can adequately inform the uninformed about this travesty of justice is to have the correct information in the first place.

  125. Original intent of Copyright by Kismet · · Score: 1

    Copyright was established for the purpose of protecting the creators from the bigger interests, such as publishers. If this were still the case, the DMCA would not be such a big issue on Slashdot.

    In recent years, we have seen a complete reversal of this intent. Copyright is now wielded by corporations to in fact protect them from the original creators, and also from the general public. Artists and authors often only see a fraction of the of the revenues generated by their work.

    The U.S. constitution was established for the purpose of protecting the people from tyranny. For example, there is a clause that guarantees the right to bear arms. Why is that in there? Well, in the event that the government should resort to tyranny, the people would then have a means of armed rebellion to restore popular rule. This was the mindset of colonial America. Obviously, that particular example is a little bit obsolete, but it illustrates an important point.

    I think everyone will agree that authors and artists and the like should enjoy the benefits of their work. Thus, it could be argued that there is a place for Copyright. However, Copyright is a power that may be wielded tyranically. It is possible today for a company to restrict how, when and where a book is read, for instance. What would stop them from abusing this power?

    The public needs a way to take back the power when it is evident that it has been abused, much like the colonials needed their right to bear arms lest their hard-earned freedom be wrenched from them again.

    Until 1998, when the DMCA was legislated, the public had this power over Copyright. I believe that Copyright should still be enforced. Outlawing the means to thwart Copyright, however, is utterly unconstitutional. We are moving from a system in which we are punished for our acts to one in which we are punished for establishing our ability to commit the act. The next step in this progression is to criminalize thinking about our actions.

  126. Bringing his family by david_g · · Score: 1

    As I'm not an american (and I never travelled outside my country) I don't know what's involved but, how hard is it to bring his family to the US while he is there? Didn't Adobe start all this? The very least they could do was to bring his family for a while so he can see them and they can see him.

    1. Re:Bringing his family by Silver222 · · Score: 1
      No kidding you've never travelled outside your country. Have you ever tried to talk to an INS officer? It's like talking to the Gestapo when you've got 20 Jew or Gypsies or Russians or Homosexuals in your attic.


      Not a pleasant experience.

      --
      "It's not a war on drugs, it's a war on personal freedom. Keep that in mind at all times." Bill Hicks
  127. This is how it works by Planesdragon · · Score: 1

    Freedom and Democracy are not things that exist naturally in the wild. Like any other faucet of civilization, they require a certain level of institutions and traditions to floursih.

    In the United States, we use our republic's democratically elected government to balance the freedoms of the many against the freedoms of the few. Somtimes, as with the DMCA, we mess up--but the fact is that we CAN mess up, and the system self-corrects us.

    Yes, it's horrible that a Russian programmer was the first one nabbed under the DMCA. But if it wasn't him, it would have been someone else--and, until his trial is over, I'm wiling to give the courts the chance to fix the law that's gone to far.

    The Courts fixed seperation in schools, line-item veto, and the legislature's scam against cannabis importation. They're a check on the other two branches, and I'm willing to let them have a crack at it before I'm "embarassed."

    As for the jusisdictional part--the US would arrest a drug dealer from Columbia, a terrorist from Iraq, or a child pornographer from China. While the DMCA doesn't rise to the level of any of those crimes, it *IS* a crime, and the other three should be treated at least as well as a DMCA violator.

    1. Re:This is how it works by dillon_rinker · · Score: 1

      the US would arrest a drug dealer from Columbia, a terrorist from Iraq, or a child pornographer from China

      Those are some really loaded words. "Drug dealing" is outlawed in Colombia (due to US efforts). Terrorism in Iraq is illegal (blow up a building there and see what happens). I don't know, but I would hope that taking pictures of children in sexual positions is just as bad in China as it is in the US.

      HOWEVER...the Russian programmer under discussion didn't violate Russian law; he violated US law. Consider the following...

      If a Colombian pharmacist dispensed morphine to a patient, but didn't follow US regulations, would we arrest him when he came to the US? If a Colombian storekeeper gave drugs to children, drugs which in the US require a prescription but which in Colombia don't, would we arrest him?

      If an Iraqi soldier fired a missile at a US jet, would we arrest that soldier when he came to the US? More likely we would give him asylum. If an Iraqi citizen blew up an Iraqi building, we'd likely give him a medal when he came here. If an Iraqi citizen blew up a US building, he'd be on US soil, violating US law...of course we'd arrest him.

      If a hypothetical Chinese photographer took pictures of babies without their clothes on because of a hypothetical custom of doing so to represent the babies' purity, should the photographer be arrested? If a hypothetical 19-year-old man married a hypothetical 14-year-old girl, with her consent, (because of a hypothetical tradition of fertile young women marrying virile young-but-older men), and if he took explicit pictures of her, for their own use and enjoyment, and if he behaved toward her as a man should behave toward his wife, would we arrest the man when he came to the US?

      If someone drives faster than 70 mph (the fastest legal speed in my state) on a Montana highway, can my state highway patrol arrest them? If I drive with a blood alcohol level of .08 (not illegal in my state), can your state police arrest me because it's illegal in their state? What if I wait until I'm sober, drive to your state, and then talk about driving almost-drunk in my state?

      My point is simply that if something is NOT morally wrong (whatever that means to you), and if it is NOT illegal for a foreigner in their own land, and if NO ONE (except corporate attorneys) understands exactly what behavior constitutes a crime, then is it right to arrest foreigners for acts committed in their homeland, when they've violated no laws on US soil?

    2. Re:This is how it works by Planesdragon · · Score: 1

      Those are some really loaded words. "Drug dealing" is outlawed in Colombia (due to US efforts). Terrorism in Iraq is illegal (blow up a building there and see what happens). I don't know, but I would hope that taking pictures of children in sexual positions is just as bad in China as it is in the US.

      Ok, so my examples weren't the best--but you do see the principle. When we arrest a drug dealer, a terrorist, or a peophile, we prosecute them under *our* laws, not the laws of their native country. When someone commits an act that affects the United States of America, and we have a law against just that act affecting us, we prosecute them. If the legislature's gone to far, the courts rule the new law unconstitutional and it's not a law any longer.

      IANAL, of course, but here are my considerations of the points you made.

      If a Colombian pharmacist dispensed morphine to a patient, but didn't follow US regulations, would we arrest him when he came to the US? If a Colombian storekeeper gave drugs to children, drugs which in the US require a prescription but which in Colombia don't, would we arrest him?

      If they were US citizens, and we had a law against such behavior, yes. Especially if they came to the US and talked about it.

      If an Iraqi citizen blew up a US building, he'd be on US soil, violating US law...of course we'd arrest him.

      What if the Iraqi launched a missle from an Iraqi street against the US Embassy? He's on Iraqi soil, after all. Does that mean we can't touch him?

      If any act can cause the government to hold someone (citizen or not) liable for what they do outside of the country, then the government can hold people liable for what they do outside of the country.

      If a hypothetical Chinese photographer took pictures of babies without their clothes on because of a hypothetical custom of doing so to represent the babies' purity, should the photographer be arrested?

      You can do that in the US, and it's not Child Pornography. If it's a picture of a sexually explicit pose of a child, you can't say "but children are so pure" and try to get away with it.

      Nudity != pornography

      If a hypothetical 19-year-old man married a hypothetical 14-year-old girl, with her consent, (because of a hypothetical tradition of fertile young women marrying virile young-but-older men), and if he took explicit pictures of her, for their own use and enjoyment, and if he behaved toward her as a man should behave toward his wife, would we arrest the man when he came to the US?,

      Good bloody question. We might, and he could probably get out on appeal if we did.

      A 19 year old CAN marry a 14 year old, even in the US. They might even be able to conjugate without violating NY's stautory rape laws.

      If someone drives faster than 70 mph (the fastest legal speed in my state) on a Montana highway, can my state highway patrol arrest them?

      Sure. The Highway patrol can arrest them for reckless driving, speeding, and potentially even harassing an officer ("obstruction of justice.") The police could arrest me right now for the murder of someone in Buffalo. The charges won't stick, but they can certainly charge me with the crime. If they're malice involved, I have recourse to sue them--which is a check that keeps them from arresting me just for the fun of it.

      If I drive with a blood alcohol level of .08 (not illegal in my state), can your state police arrest me because it's illegal in their state?

      Of course not. The NY law (which is, IIRC, .10 anyway) only applies to NY roads.

      If a child with a BAB of .05 drove in a state where that was not illegal, but their home state's DMV revoked the license of any child driving with any BAB, the child would, hypothetically, lose their driver's license.

      What if I wait until I'm sober, drive to your state, and then talk about driving almost-drunk in my state?

      Unless there is a law against it, you've committed no crime.

      The Age of Consent in NY is 17, but because the Statutory Rape law doesn't forbid a 16 year old and an 18 year old from getting it on, it's not a crime.

      My point is simply that if something is NOT morally wrong (whatever that means to you), and if it is NOT illegal for a foreigner in their own land, and if NO ONE (except corporate attorneys) understands exactly what behavior constitutes a crime, then is it right to arrest foreigners for acts committed in their homeland, when they've violated no laws on US soil?

      That's a loaded question.

      No, it's not right for the law to hold someone to a wrong that is only a legal wrong, and not a clear ethical wrong when they have no way of reasonably knowing that the law will be applied to them.

      However, it is right for the officers of the law to enforce it as it is written. That's doing their job, and they should be fired if they don't. Selective negligence to encourage following of the law is one thing; ignoring the law alltogether is something else.

  128. Re:General note to anyone reading by Anonymous Coward · · Score: 0

    Hey fuck you. I just don't think that anything copy-protected is valuable enough to unencrypt without the author's permission. If anyone wants to ferret away information, that's their (and my) FREEDOM to do so. My vision of a free future is one where I can be secure in my papers. The point of free information movement is that we'll make our own information and it'll be twice as good as the non-free stuff. The point is /not/ to impose our ethics onto others just because we have the technology.

  129. America once again thinks it controls the world by Anonymous Coward · · Score: 1, Insightful

    If American's can prosecute visitors who do stuff legally in their own country that would be illegal in the USA I think other countries should do this too.

    This means those American's:

    1. Owning handguns will now be arrested on entry to the UK regardless of whether they have a gun on them at the time

    2. Who do not practice Islams will be arrested on entry to Saudi Arabia

    The list could go on.

    I'd also advise any Dutch people who may have legally smoked pot not to enter the USA as you're logically as much a target.

    [)

    1. Re:America once again thinks it controls the world by fishbowl · · Score: 2



      >I'd also advise any Dutch people who may have
      >legally smoked pot not to enter the USA as
      >you're logically as much a target.

      Not as far fetched as you might think. Smoke pot legally in Holland or anywhere else where it's legal, and get on a plane to Reno NV. Nevada, where it's against the law to be under the influence of MJ, could prosecute you on the
      basis of a drug test weeks afterwards.

      --
      -fb Everything not expressly forbidden is now mandatory.
  130. my analogy by underwhelm · · Score: 2

    Imagine driving on the freeway at 65 mph, and getting pulled over because the speed limit in the alley behind your house is 10 mph.

    This concept used to be called jurisdiction--that a law has certain an area of geographical effect beyond which it doesn't apply. The 10 mph limit is only in effect on streets designated as 10 mph zones. Apparently the IP Patrol of the US feels it can enforce it's 10 mph limit on other country's freeways.

    What we're learning (that military types always knew) is that a law's jurisdiction has nothing to do with it's claimed geographical borders, and everything to do with sheer ability to enforce the law. All the explicit and implicit limitations on laws stand only until a more powerful will chooses to ignore them. To say that the 10 mph limit only applies to the alleyway is just an empty promise, not a physical certainty. If an enforcement body chooses to enforce the laws of one jurisdiction on another, only political or physical resistance would stop them.

    --

    I don't need large brains to have a good time.

  131. The light side of the DMCA .... by PCHell · · Score: 0

    While I hate the DMCA, I admit that in certain areas it might serve a good purpose...

    There are thousands of warez sites right now, distributing game cracks and justifying it as "Educational Purposes". The DMCA will end this for good (if its not knocked off as inconstitutional)

  132. Don by bridgette · · Score: 1

    Unfortunately, a plea of not guilty will not lead to a legal examination of the DMCA either, at least not directly. The court's duty is to enforce the existing law, not to ratify or amend it. As I understand American law, the judge is not at liberty to simply say, "Well, this law is clearly unfair. Therefore we'll just have to release Mr. Skylarov." His only duty is to determine whether or not Skylarov violated the DMCA, and issue an appropriate sentence.

    Perhaps the judge can't just proclaim the law as unfair and

    --
    - bridgette
  133. Interesting Quote by avalys · · Score: 2, Insightful

    From the article on yahoo -
    "Sklyarov, 26, spent 21 days in prison before being freed on bail amid noisy protests by advocates of free speech and other supporters. He pleaded not guilty." (my emphasis)

    I wasn't aware that the U.S needed any advocates of free speech.

    --
    This space intentionally left blank.
    1. Re:Interesting Quote by JohnnyBolla · · Score: 1

      Then, my brother, you have not been paying attention.

      --
      Carpe Deez
  134. Is it the country or the corporations? by WyldOne · · Score: 1

    IMHO, it's the corporations that have too much power. They use their money as power and hire fleets of lawers to trick and confuse the judges. Take the Microsoft monopoly case for instance. They dragged out that case, and are still doing so. Diverting the issues away from the real problems at hand. (As someone mentioned the bootloader issues)

    --

    make Linux, not Microsoft. sin(beast) = -0.809016994374947424102293417182819
  135. DeCSS got more attention by HenryFool · · Score: 1

    I assume Jacobs is referring to DMCA cases. The 2600 v MPAA DeCSS case got tons of attention last year, probably more than Skylarov's. It was all over the New York Times. This guy Jacobs is probably just out of touch, as one would expect from a US attorney spokesperson.

  136. Don't blow off jury duty!!!! by bridgette · · Score: 4, Insightful

    Unfortunately, a plea of not guilty will not lead to a legal examination of the DMCA either, at least not directly. The court's duty is to enforce the existing law, not to ratify or amend it. As I understand American law, the judge is not at liberty to simply say, "Well, this law is clearly unfair. Therefore we'll just have to release Mr. Skylarov." His only duty is to determine whether or not Skylarov violated the DMCA, and issue an appropriate sentence.

    Perhaps the judge can't just proclaim the law as unfair and set Skylarov free, but the jury can refuse to convict him for any reason - even if they just don't like the law in question. If the trial is in Frisco, then there's a good chance that there will be some geeks on the jury (especially since there are so many out of work geeks there these days)

    http://www.erowid.org/freedom/jury_nullification /j ury_nullification.shtml
    http://www.fija.org/
    http://civilliberty.about.com/cs/jurynullificati on /

    (please disreagard the previous psudo post, I accidentally hit return when the focus was on the "Submit" button)

    --
    - bridgette
    1. Re:Don't blow off jury duty!!!! by vsync64 · · Score: 1
      If the trial is in Frisco, then there's a good chance that there will be some geeks on the jury (especially since there are so many out of work geeks there these days)
      Actually there will probably be no geeks at all. The lawyers will ask everyone if they have any computer experience and dismiss those people as "prejudiced". Additionally, lawyers tend to dislike people with technical and/or logical experience, because they can't use emotional manipulation which would be easily seen through. The idea of "a jury of your peers" is a sad joke.
      --
      TO BUY A NEW CAR WOULD MAKE YOU SEXUALLY ATTRACTIVE.
  137. You're very wrong by Gorimek · · Score: 2

    So how do you explain that democracy only ever appears in capitalist societies??

    I don't deny the growing corporatist problems in the US, but remember that a country run by corporations is not capitalist, it's fascist.

    Study history. Don't believe all the cool charismatic rebellious people tell you. Nor, for that matter, whining old men like me.

    1. Re:You're very wrong by guygee · · Score: 1

      I think it is your precedence that has a problem. Democracy preceded capitalism, which in turn preceded corporations.

    2. Re:You're very wrong by guygee · · Score: 1

      BTW, one of the best readings I have found on this topic is "The Great Transformation" by Karl Polyani. Polyani provides extensive documentation and exposition for the development of today's market economies over the last two centuries. In particular, he points out the tremendous amount of effort spent on social engineering to accomplish the commodification of land, labor and capital. The market economy is a very modern feature of human existence, put into place only with a great deal of social dislocation and cultural destruction over the past 200 years.

    3. Re:You're very wrong by hearingaid · · Score: 3

      how bizarre.

      democracy dates back a long time before capitalism. we could go back to ancient athens. you might not think of that as democratic though. we could go to tenth-century iceland. (iceland, where they still haven't bothered with capitalism. they did get democracy, back, though. capitalism. what a crazy idea. :)

      capitalism also dates back before democracy. that is, unless you think of early nineteenth-century Britain, the birthplace of capitalism, as democratic. I'm unsure as to whether I'd call it democratic now. never mind before 1832.

      fascism is also not rule by corporations. that's what we call feudalism. (our modern feudal lords use intellectual property rights instead of land rights. both are fictions of the law.) fascism is rule by gangs: it was named after the fascisti, and a key component of Nazism as well as the Mussolini and Franco regimes was the gangs of thugs who kept people in line.

      --

      my old sig used to be funny, but then slashcode ate it and now it's not funny anymore

    4. Re:You're very wrong by Gorimek · · Score: 2

      Well, it comes down to how you define all these terms. With my definitions, my statement is right. With yours, it's probbaly not.

      Still there is a reality behind what I'm saying, regardless of what terms you use. Mass democracy is only found in free market based economies. The (more or less) free markets come first, followed by an economic upswing that builds a (more or less) prosperous middle class that can't be bossed around anymore, and then democrazy follows, after some more or less wild disturbances. I expect China to go that way within 10-20 years. I'm hoping for "less wild", but I'm not too confident.

      Athens was a democracy for the small minority of non slave males. I don't really know about their economy, but it was hardly a centrally planned one.

      I don't know what you heard about Iceland, but it's is a perfectly normal western capitalist welfare state. Back in the day, it was more anarchist than democratic, due to the lack of a state, among other intriguing features. See http://www.hi.is/~bthru/friedman.htm

      Feudalism has nothing to do with corporations. It's about kings and local lords and owning the peasants in exchange for providing defense. Mussolinis big invention (after his time as a socialist) was the corporatist state.

      All states need gangs of thugs to keep people in line.

      I could argue all day, but there is nobody reading this except us this late anyway, so why bother.

  138. "Effectively" doesn't mean what you think it does by Noel · · Score: 1

    [IANAL]

    I keep seeing this argument that if the TPM is easily broken, then it's not effective, so the DMCA doesn't apply. I'm sorry, but as much as I would wish that to be true, it doesn't appear to be. In 1201(a)(3)(b), the DMCA clearly defines its meaning:

    a technological measure "effectively controls access to a work" if the measure, in the ordinary course of its operation, requires the application of information, or a process or a treatment, with the authority of the copyright owner, to gain access to the work.

    In other words, the question is not whether the TPM provides adequate protection against unauthorized access, but whether it has the effect of controlling access when it is used as intended by the copyright owner. Circumventing the TPM is not the "ordinary course of operation", so it doesn't matter how easy it is to crack the encryption.

    Sorry, but this looks horribly well written. It gives the copyright owner the unquestioned right to put in place any mechanism that controls access in any way to the intellectual property, whether or not that control is granted by copyright law. That's the worst part of this law. It allows the copyright owner to extend the arenas of access control in any way they wish (region codes, forced ads, licensed hardware, etc.), and makes it a federal offense to go against the wishes of the copyright owner.

    <rant>Every time I read this, it nauseates me to think that laws like this can be passed unanimously in this supposedly "free" country.</rant>

  139. What happened? by Anonymous Coward · · Score: 1, Interesting

    Below is a clip from something I hope most of you have read before. Please read it through again in light of the events around you today. What would our founding fathers think of our present situation? Yes, it is not the constitution, but rather the paper that started the U.S. off. It's funny how far we have come in only a little over 200 years...

    IN CONGRESS, July 4, 1776.

    The unanimous Declaration of the thirteen united States of America,
    When in the Course of human events, it becomes necessary for one people to dissolve the political bands which have connected them with another, and to assume among the powers of the earth, the separate and equal station to which the Laws of Nature and of Nature's God entitle them, a decent respect to the opinions of mankind requires that they should declare the causes which impel them to the separation.
    We hold these truths to be self-evident, that all men are created equal, that they are endowed by their Creator with certain unalienable Rights, that among these are Life, Liberty and the pursuit of Happiness.--That to secure these rights, Governments are instituted among Men, deriving their just powers from the consent of the governed, --That whenever any Form of Government becomes destructive of these ends, it is the Right of the People to alter or to abolish it, and to institute new Government, laying its foundation on such principles and organizing its powers in such form, as to them shall seem most likely to effect their Safety and Happiness. Prudence, indeed, will dictate that Governments long established should not be changed for light and transient causes; and accordingly all experience hath shewn, that mankind are more disposed to suffer, while evils are sufferable, than to right themselves by abolishing the forms to which they are accustomed. But when a long train of abuses and usurpations, pursuing invariably the same Object evinces a design to reduce them under absolute Despotism, it is their right, it is their duty, to throw off such Government, and to provide new Guards for their future security.--Such has been the patient sufferance of these Colonies; and such is now the necessity which constrains them to alter their former Systems of Government. The history of the present King of Great Britain is a history of repeated injuries and usurpations, all having in direct object the establishment of an absolute Tyranny over these States. To prove this, let Facts be submitted to a candid world.

  140. Speaking of liability by alsta · · Score: 1

    I saw a banner ad for a Cable TV descrambling device so that you can watch HBO for free. These devices are PERFECTLY LEGAL to sell in most states, if not all. They are also PERFECTLY LEGAL to purchase in most states, if not all. But once you start using it with the intent of watching pay channels for free, it stops being legal.

    So in essence Dmitry could have come here to the U.S and sold the program to anybody who wanted to buy it. Legally. It is when somebody starts using it with the intent of redistributing the illegalities start to kick in.

    But the reason Dmitry can be found guilty of a crime and the producer/distributor of the Cable TV descrambler can't, is that there is a law called the DMCA which protects Big Business(tm).

    Alex

    --
    Wealth is the product of man's capacity to think. -Ayn Rand
  141. It's not about improving security by gotih · · Score: 1

    There is a legitimate market for Dmitri's software -- people who have purchased ebooks and wish to have the book on more than one computer. Dmitri's product was intended to help those people. the fact that adobe wrote poor software only allowed him to accomplish this.

    If Ford actually made locks so poorly that you could create a key that opened all Fords I'm sure you could create and market it as a "Universal Replacement Key" for all Fords. sure, Ford would try to stop you but it would certainly be thier fault that they created a faulty lock.

    In fact there is a product designed to unlock nearly all cars - the Slim Jim. If you're cheap, use a bent coat hangar. When I lock my keys in my car (quite often) I can have my Honda CRX door open in less than a minute with a coat hangar. Should coat hangar manufactures and other medium diameter steel rod manufactures be sued because thier product doesn't discriminate between legitimate fools (myself) and criminals and can be used for "evil?"

    Had adobe created a system where users could, for a small fee and with some identification (CreditCardNo), purchase the right to move the an ebook from one computer to another perhaps this would not have happened. however, i would have a problem with that system.

    At question here is whether or not a person working in the digital world has the same rights as someone in the analog world. I say yes (as would Thomas Jefferson), DCMA says no.

    --

    fear is the mind killer
  142. on another note... by Kraft · · Score: 2

    (offtopic, but pretty funny)

    A friend of mine got on a plane in South America, which was heading towards Europe. With him, he brought a nice big space-cake (=hash cake), knowing that the customs/police wouldn't check anything until he landed. While in air he ate the sucker and had one hell of a flight home.

    --

    -Kraft
    Live and let live
  143. Martin Luther King's take on the DMCA by goingware · · Score: 3, Insightful
    One has a moral obligation to disobey unjust laws..
    -- Martin Luther King

    In more detail - the Supreme Court does not render advisory opinions. That is, you cannot simply ask the court to judge whether a law is constitutional or not. To have a law declared unconstitutional, one must actually violate the law and pursue one's defense to the highest court in the land.

    The benefit of having unjust laws struck down by the Supreme Court comes at the cost of risking one's freedom if one's attempt proves unsuccessful - or even one's life, in the event the law in question provides for capital punishment.

    --
    -- Could you use my software consulting serv
  144. I wonder, I hope the DoJ is doing this because... by Aexia · · Score: 2, Insightful

    They're oppose DMCA.

    I mean, what other way is there to get rid of DMCA right now? Have Congress repeal it? Yeah right.

    OTOH, if he were convicted and the convicted was overturned on grounds that the DMCA was unconstitutional, that'd be good...

    Maybe that explains why DoJ is so headstrong on "convicting" an easily popularized guy? They know the case will eventually lose and they want it to because that's the only way to get rid of it.

    Of course, it's inconvienent for Dmitri, but then again, someone's gotta be the martyr and it might as well be someone who isn't an American.

  145. Note to G.W. Bush's handlers.. by jcr · · Score: 3, Interesting

    The *smart* thing to do, is pardon Sklyarov.

    That way, your corporate masters get to keep this blatantly unconstitutional bludgeon around to threaten anyone else who seeks to expose their incompetence. The longer you keep the DMCA out of court, the more damage it can do to the constitution your sock-puppet took an oath to uphold.

    -jcr

    --
    The only title of honor that a tyrant can grant is "Enemy of the State."
  146. Jury Nullification by Anonymous Coward · · Score: 0

    Even where the law is wrong it must be obeyed

    Our founding fathers disagreed with you. In
    the United States legal system there is a principle called Juror
    Nullification , whereby if a jury finds a defendant innocent of any
    genuine wrongdoing, they can declare them nonguilty, even if they have
    in fact broken the letter of the law beyond any reasonable doubt.

    -- Guges --

  147. Reply to Senator Feinstein's DMCA form letter by snogwozzle · · Score: 2, Informative

    Senator Feinstein sent me a form response (see below) to my DMCA letter, and I find it unsatisfactory in the extreme. So I sat down to write her back, and thought some of you might find the result worth reading.

    Dear Senator Feinstein,

    First, thank you for considering the Digital Millennium Copyright Act issue important enough to develop a response for it.

    When I first wrote you, I implored you to become active in seeking appropriate adjustments to address the worst excesses of the DMCA. I am sorry to say that I have been hoping for a more substantial reply than the one I received.

    Yes, everyone agrees that a digital economy requires legal protections. But in any effort there is always the question of how much is enough, how much is too much, and what is lost by doing too much. News developments since I first wrote you make it more and more clear every day that the DMCA went too far, and, now that criminal enforcement has begun, that it is beginning to trounce the legitimate activity and normal relations of the technology ecosystem, is chilling public speech, and is distorting markets. Russian grad student Dmitry Sklyarov is facing 25 years in a US prison, plus a $2.5 million fine for writing a computer program in another country. I'm sure you're aware that today the Russian government issued a warning to Russian computer technologists that they should not travel to the US because they risk imprisonment! Encryption researchers have begun to resort to anonymity when publishing their results, even in other countries. The situation is quite drastic, global in scope, and I must say requires closer examination and more action than your reply would indicate you plan to take.

    The constitutional copyright mandate is for Congress to provide laws to ensure adequate compensation for creators to bring new works forth -- not to guarantee every possible compensation for every imaginable use of every copy of every work. You analogize intellectual property rights to physical property rights, but any copyright scholar will tell you that intellectual property rights have never entailed the same kind of rights as physical property rights, and for good public policy reasons (see for example the writings of Jefferson). I should be able to listen to the CDs I buy on my computer and in my car without paying again. I should be able to watch a DVD I buy in England when I get home without paying again. I should be able to watch a DVD I buy on my computer, even if it's a Linux computer without a CSS player. I should be able to back up my e-books without having to pay again. When the DMCA went too far, I lost those rights. I also lost my ability to protect myself against the objectionable practices of the copyright industries, whose interests are, after all, different from mine as a consumer. If I were to try to regain my rights, simply by using my ordinary computer industry skills, I could go to prison for 5 years per each copied item. This is not piracy. This is not bootlegging. This is not mass duplication. Let those stay illegal. This is basic consumer rights.

    To my mind, the most egregious aspect of the DMCA is that by criminalizing the circumvention of access control technologies even for media that the consumer has bought and paid for (and no matter how flimsy the protection), the Act requires the American people's own government to act against them, as enforcer of the copyright industries' purely self-serving business initiative to get them to pay for every movie, program, song, and book over and over and over again -- ultimately, to pay for every single access. Imagine your home library with a coin-operated lock on every book. That is our future if the DMCA is not amended.

    So I respectfully ask you again, at a minimum, to clarify your position as to whether you will help to adjust the areas where the DMCA is clearly excessive, or whether you will oppose such efforts. I would like to think that you can appreciate the gravity of the situation, and the depth of the discontent of your technically-minded constituents, and will act in the people's interest.

    In considering this question, please don't accept at face value the copyright industry's self-serving assertion that only perfect protection will prevent economic collapse in movies, music, publishing, and software. In the DMCA, America traded away the rights of consumers and the free speech rights of technologists in order to achieve a 'perfect protection' scenario by inventing draconian criminal penalties for otherwise ordinary and accepted activities. But cryptographers know very well that perfect protection is impossible, and always a red herring. 'Pretty Good Protection' -- meaning relying on ordinary civil copyright protection, and reserving draconian criminal penalties only for those who mass-distribute copies that could replace sales -- is good enough to keep the copyright industries in business, and just as profitable as they have been, without requiring us to trounce consumer rights and throw our brightest programmers and researchers into prison.

    I know that the studio heads in Hollywood are your constituents, but please keep in mind that you also represent the young technologists who work in Silicon Valley. Please, reconsider adjusting the anti-circumvention aspects of the DMCA.

    Sincerely,
    --- Snogwozzle
    Bay Area, California

    Dear Mr. Snogwozzle:

    Thank you for writing to me about the Digital Millennium
    Copyright Act.

    I have always believed that the protection of intellectual
    property rights is as important as the protection of any other
    property right. Moreover, the protection of intellectual property is
    vital to a flourishing economy -- particularly in California.
    America's music, movie, and software industries are second to
    none, and we export far more intellectual property than we import.
    This is good for employment, and good for consumers.

    Without strong copyright protections, the incentive to
    innovate would be diminished. In fact, this issue was so important
    to the Founding Fathers that the ability of Congress to protect
    copyrights is actually written into our Constitution itself.

    The Digital Millennium Copyright Act was Congress'
    attempt to address the issue of copyright protection in a new,
    digital age. As new technologies have developed over the past few
    years, it has become increasingly difficult to protect intellectual
    property from illegal copying and distribution. It is a delicate
    balance, to be sure -- nobody wants to restrict the development of
    new and exciting technologies, but we must work to prevent the
    creation of perfect, digital copies of copyrighted works which can
    be illegally distributed throughout the world.

    Please be assured that I understand your concerns, and I
    will keep your views in mind.

    If you have other questions or comments, please do not
    hesitate to write to me again, or contact my Washington, D.C. staff
    at (202) 224-3841.

    Sincerely yours,

    Dianne Feinstein
    United States Senator

    1. Re:Reply to Senator Feinstein's DMCA form letter by Natalie's+Hot+Grits · · Score: 1

      Do you mind if i use this letter for my senators, etc.? If you dont want me to copy it, i won't, but it is very nice, and i will post any revisions i make to it if it pleases you. I will probably turn it into a more general letter. (ie, not a reply to what my senator said to me)

      what do you say?

      thanks.

      --
      Two infinite things: your stupidity and mine. But I'm not sure about the latter. If my sig offends you, I'm sorry.
  148. Thanks to all by Pinball+Wizard · · Score: 2
    who replied to my comment. After reading through all the comments it is clear to me that I made a really bad analogy.


    A better one might be that if replicators of physical objects existed, we would likely see restrictions on what objects we could copy. And, someone who provided a way to defeat those restrictions would probably face jail time.


    I don't think Skylarov belongs in jail. However, I think that people who create digital things like software or music should be able to limit the amount of free copying that happens to their creation. In my opinion the only real way of doing that is to build a culture of respect - respect for the authors of software, music, movies, etc. Its likely that NO lock, encryption method or other security device is 100% secure. Therefore the only way to really have things be secure is if the vast majority of people respect laws and copyrights.


    If the vast majority of people do not respect the law, then we have a serious problem. I'm not talking about unjust laws like the DMCA. I'm talking about the copyright laws that get broken every day by people who wouldn't even consider shoplifting. We have to build a culture of trust and respect, or else we may have to watch our digital society be replaced by something far more draconian.

    --

    No, Thursday's out. How about never - is never good for you?

    1. Re:Thanks to all by Anonymous Coward · · Score: 0

      Russian Foreign Office issued a warning to all programmers working with US companies that they can be jailed in US irellevant to their respect of home law because of DMCA.

      http://www.nns.ru/chronicle

  149. I wrote Diane Feinstein a letter about the DMCA by Anonymous Coward · · Score: 0

    And this is what I got back from her. She's truly clueless as to what fair use is let alone it's value in in our society. My comments to hers are in () AND CAPS

    Dear Mr. Pxxxxxx:

    Thank you for writing to me about the Digital Millennium Copyright Act. I have always believed that the protection of intellectual
    property rights is as important as the protection of any other property right (AND THE HELL WITH THE RIGHT OF INDIVIDUALS' FREE SPEECH). Moreover, the protection of intellectual property is
    vital to a flourishing economy -- particularly in California. America's music, movie, and software industries are second to none, and we export far more intellectual property than we import.
    This is good for employment, and good for consumers (SO YOU SHOULD BE HAPPY TO GIVE UP YOUR CONSTITUTIONAL RIGHTS TO HAVE A JOB!). Without strong copyright protections, the incentive to innovate would be diminished (AND CORPORATIONS WOULD GIVE ME LESS CAMPAIGN $$$). In fact, this issue was so important to the Founding Fathers that the ability of Congress to protect copyrights is actually written into our Constitution itself (ALONG WITH THE RIGHTS OF FREE SPEECH AND EXPRESSION, DIANE).
    The Digital Millennium Copyright Act was Congress' attempt to address the issue of copyright protection in a new, digital age.
    As new technologies have developed over the past few years, it has become increasingly difficult to protect intellectual property from illegal copying and distribution. It is a delicate
    balance, to be sure -- nobody wants to restrict the development of new and exciting technologies, but we must work to prevent the creation of perfect, digital copies of copyrighted works which can be illegally distributed throughout the world (AND IF WE HAVE TO BLOW AWAY THE RIGHT OF FAIR USE AND WE HAVE TO PUT PEOPLE IN JAIL BECAUSE THEY WANTTO FREELY EXPRESS THEIR OPINIONS, SO BE IT). Please be assured that I understand your concerns, and I will keep your views in mind (BUT DON'T EXPECT ME TO DO ANYTHING ABOUT THEM, 'CAUSE HOLLYWOOD PAYS MY FREIGHT!).
    If you have other questions or comments, please do not hesitate to write to me again, or contact my Washington, D.C. staff at (202) 224-3841.

    Sincerely yours,

    Dianne Feinstein
    United States Senator

    http://feinstein.senate.gov

    (PRETTY PATHETIC, HUH)

  150. I find it very ironic that.... by Anonymous Coward · · Score: 1, Interesting

    The Russian foreign ministry has warned Russian programmers to stay out of the U.S. because of their laws oppressively limiting free speech!

    ``We want to point out to all Russian specialists cooperating with U.S. firms in computer programming and software design that, whatever the outcome of Sklyarov's case, they may fall under the jurisdiction of the 1998 Act on the territory of the United States,'' the Foreign Ministry said in a statement

    Wasn't Russia formerly the place where people could be put in jail without being charged with a crime? Isn't the U.S. supposed to be the only place where one can express an opinion without being jailed for it?
    Is it me or is this a total reversal of the past?

    1. Re:I find it very ironic that.... by jedwards · · Score: 1

      Isn't the U.S. supposed to be the only place where one can express an opinion without being jailed for it?

      No. There are plenty of places where there is freedom of speech ... the US didn't invent freedom you know!

  151. Parasitic Open Source by nytes · · Score: 1

    What would happen if Open Source developers added a use-restricted clause to their software. i.e. a clause that states that "this software can not be used for the monitoring or enforcement of intellectual property."

    Furthermore, ISP's must notify their users of this in the terms of use.

    Violators are subject to fines of $10K (per violation) or double the damages recovered in any IP suit.

    Microsoft and others set similar restrictions on their software. (e.g. Visual C++ can't be used to develope an OS.)

    Of course, since people are now considered guilty until proven innocent, you could probably have companies like Rangerinc shut down with little more than suspicion that they 'might' have used Open Source software. After all, some of their traffic probably routed through a Linux machine, right? You could certainly drag them into court and make them detail all the software they use. Then maybe seize a few computers for random inspection.

    --
    -- I have monkeys in my pants.
  152. Defense fund by Omnivorous+Cowbird · · Score: 1

    From the Elcomsoft press release:

    Those interested in contributing to Sklyarov's defense fund should make donations by wire to:

    First Union National Bank
    Philadelphia, PA
    ABA #031201467
    Account #: 2000104359781
    Account Name: Duane, Morris & Heckscher LLP
    Escrow Account

    Contributors MUST reference "The Dmitri Defense Fund - R0247-2" on all incoming wires.

    Donations by Check should be sent to the following address:

    The Dmitri Defense Fund
    c/o Duane, Morris & Heckscher LLP
    100 Spear Street, Suite 1500
    San Francisco, California 94105
    USA

    Checks must be payable to "DMH Escrow Agent for Dmitri Defense Fund."


    Just in case anybody didn't read the article...

    --
    ______________________________________
    Ever notice how fast Windows runs? Neither did I...
  153. Thank you. by Anonymous Coward · · Score: 0

    I would have liked, however, to replace some of those "i"'s with bars, but unfortunately doing so manages to trip the lameness filter (at least it did when I composed the image; the filter seems to be changing daily).

  154. Adobe must be held responsible by Anonymous Coward · · Score: 1, Insightful

    Adobe instigated this prosecution and must be held responsible for the consequences of their actions. Adobe should fund the defense and appear as defense witnesses. Adobe should grant full authorization to Skylarov and Elcomsoft, retroactively. If they do not fulfill these basic duties, Adobe must be held responsible for the consequences to Skylarov, his family, and Elcomsoft, a tooth for a tooth, an eye for an eye, and a life for a life.

  155. Please, people, comment on feinsteins reply. by nyet · · Score: 2

    If there are any good comments on this, I will personally compile them and send her a response letter.

    Some hints on various places to attack:

    I have always believed that the protection of intellectual
    property rights is as important as the protection of any other
    property right. Moreover, the protection of intellectual property is
    vital to a flourishing economy -- particularly in California.
    America's music, movie, and software industries are second to
    none, and we export far more intellectual property than we import.
    This is good for employment, and good for consumers.


    This paragraph is Feinstein basically saying that $$$ is more important than her constituents freedom. While this comes as no surprise, don't you think its interesting that she has enough cahones to actually come out and say it?

    Without strong copyright protections, the incentive to
    innovate would be diminished. In fact, this issue was so important
    to the Founding Fathers that the ability of Congress to protect
    copyrights is actually written into our Constitution itself.


    This completely ignores T. Jefferson's many misgivings over IP law (do a search on google, this is quoted plenty by others quite a bit). Not only that, but the wording in the Constitution itself is VERY weak. Nowhere in the Constitution does it say that Corporations' monetary interests should be protected at all costs with PERMANENT monopoly status (see also Congress' affection for extending copyright/patent durations every few years)


    but we must work to prevent the
    creation of perfect, digital copies of copyrighted works which can
    be illegally distributed throughout the world


    This illuminates a fundamental flaw in her understanding of information theory. Bits are bits. They are by definition "perfectly copiable" No amount of wrangling is going to prevent them from being copyable. The only thing that will prevent copying of bits like this is a complete police state, which she seems to think is a small price to pay to protect the California entertainment industry's enormous profits.

  156. A Response from Russia - translation by VP · · Score: 1

    Translation of the Russian Foreign Ministry announcement:

    DECLARATION BY THE OFFICIAL REPRESENTATIVE OF THE FOREIGN MINISTRY OF RUSSIA
    Regarding the trial of the Russian programmer D. Sklyarov, arrested in the USA

    We carefully follow the developments of the trial of the Russian programmer Dmitriy Sklyarov, who was arrested in the USA based on the "Digital Millennium Copyright Act". This is the first application of this law in practice. Passed in 1998, it brings opposing reactions from lawyers, incuding those in the US, many of whom think that the law infringes on the consumer's rights of transmission of digital data(*).

    The first trial meeting took place on August 30 this year, in San Jose, CA, where D. Sklyarov was charged on several counts, which may result in up to 25 years jail time. At the meeting D. Sklyarov entered a plea of not guilty. His lawyers believe the charges are unsubstantiated and they plan to prove that the arrest was a violation of the Russian citizen's free speech rights.

    The Ministry of Foreign Affairs of Russia, and its offices abroad keep in constant touch with the American authorities, the defendant, and his lawyers.

    We would like to point out to all Russian professionals, who cooperate with American companies in the areas of computer software and programming, that regardless of the outcome of D. Sklyarov's trial, the Act of 1998 may be applicable to them on US teritory.

    August 31, 2001

    (*)I believe this is supposed to mean "Fair Use rights" but I chose to translate it literaly.

    Commentary: I don't know how native Russian speakers would interpret the original (I am not one), but this sounds more like a warning to the Russian programmers not to violate the DMCA unless they want to be charged when/if they go to the US, rather than suggesting they should not go to the US. Maybe I am overreacting, but I see this as an indication that the DMCA is actually very close in spirit to the Communist laws of the Soviet past - so close that the Russian government is finding it understandable.

  157. /. is a NYTimes subsiduary by Anonymous Coward · · Score: 0

    Why dont you stop linking to NYTimes, im sure there are otehr *GOOD* sources of information around.

  158. accountability and responsibility for the DMCA by hyrdra · · Score: 2

    What should happen, is if the jurors find Sklyarov not guilty due to the DMCA being unjust, we should seek punishment of the senators who passed this law. They should be made accountable for it. After all -- they said it was legal and worth passing in the first place.

    --


    "I'll just chip in a bit for RedHat: I actually have that installed on my university machine." - Linus, '95
  159. Strange by Anonymous Coward · · Score: 0

    It seems to me that the US companies that provided the website and handled the payments and the five Americans who purchased the program are clearly in violation of the DMCA. Why aren't they being prosecuted?

  160. Details??? by dachshund · · Score: 2

    If he'd broken the law while he was in the country, then you'd be absolutely right. However, he's actually charged with creating the software. Nobody claims he did this inside of the USA's borders-- even the FBI stipulates that he did it in Russia. So if he's not charged with breaking any US laws while inside of the US, then why is he in jail??

  161. YHBT. YHL. HAND. by Anonymous Coward · · Score: 0

    Christ, this guy was featured on the Troll edition of America's Most Wanted. BTW, the *BSD is dying guy is still on the loose.

  162. OK, I'll bite... by Anonymous Coward · · Score: 0

    What does your sig mean?

    I found nothing on Google.

  163. Is this the same Elcomsoft that makes spam engines by Anonymous Coward · · Score: 0

    I fell very sorry for mr Skylarov but it seems he works for Elcomsoft. Is this the same Elcomsoft that makes spam engines that don't take a 5xx reply for NO when used by spammers?

    If so it won't help his case, I fear.

    You shouldn't keep bad company when you want to stand up for your principles.

  164. UK specific - Re:DMCA coming to Europe by dackroyd · · Score: 1

    There is a UK specific part of the Eurorights group which can be found at uk.eurorights.org.

    --
    "Free software as in beer, copy protection as in racket" - Telsa Gwynne
  165. A total deviance in topic by hearingaid · · Score: 1

    I've actually lived in Iceland. It's not capitalist. They accept restrictions on the market that would make most Americans, including many who consider themselves quite left-wing, react with horror.

    Medieval Iceland wasn't precisely anarchist. They did have a court system, for example. There was a lack of an organized executive, yes, but that's not quite the same thing. (Although I used to think so when I was a teenager, so I understand the confusion. :)

    Feudalism has everything to do with corporations. It was what created them: before the feudal state, there were no real corporations. After feudalism, we have the great corporate landowners (guilds, churches, chivalric orders and so on).

    The important point about feudalism is that it is based on fictional property rights. People can't own land the way they own personal property: at least, not most of the land. (You can effectively control access to houses and that sort of thing.) Our land law is still built on the illusion that people can really own land. For example, if I rent an apartment, I can change the locks, thus denying my landlord physical access to the land - yet he, she or it still owns the land, and can even sell it legally. This is the essential rule of real property which underlies feudalism, and which we continue to follow in the modern era. A careful examination of pre-feudal, especially non-agrarian, legal systems will reveal a complete absence of this fictional kind of property. With my computers, if I don't have access to the machines themselves, then I don't own them. Perhaps somebody has stolen them from me: but I still don't have them, and I can't sell them to somebody else until I get them back. Real property, on the other hand, can't be stolen. Intellectual property is like real property: it's a legal fiction, granting rights which could not be obtained without the force of the law. I think that modern technology corporations bear remarkable similarity to some of the larger medieval corporations, such as some of the chivalric and monastic orders.

    States need gangs of thugs: but in most states, they're organized in some way and follow the dictates of the state. In a fascist state, the gangs are non-organized and act as a primary directing force of the state, in a similar way to the way that they act in organized crime. Examine the history of the fascisti in particular.

    As for whether people are reading this, much to my surprise I got modded up (I'm always surprised, I never can figure out why: many of my best comments languish in obscurity, while my offhand jokes get modded up and down eighteen times; I don't get it) on my first comment, so maybe we do have fans. after all, geeks read this site. :) however, I will skip my bonus from now on.

    --

    my old sig used to be funny, but then slashcode ate it and now it's not funny anymore

  166. Do most people speak english in Russia? by flatrock · · Score: 2

    Do you really think that the software sold in the US had it's menus and help in Russian? He obviously knew the software was being written for export outside of Russia.
    He wrote the software. His employer paid him to write the software. If the law was broken (that's for the court to decide), he profited from the crime. I also don't think he was unaware that it would be sold in the US. I curious how US laws address this, I'll definately be watching this case carefully. I've just found that in the past when something seems as unreasonable as Mr Sklyarov being charged with a crime in the US, there is usually more to the story. I also know that prosecuters don't like to prosecute high profile cases unless they've got a good chance of winning. I'm going to wait until I hear more about the evidence before I decide if I think Mr Sklyarov is a innocent victim.

    1. Re:Do most people speak english in Russia? by rking · · Score: 1

      Not jumping to conclusions too soon and wanting to hear the evidence as the case progresses is very reasonable.

      The thing about language is just a red herring though, even leaving aside the fact that English is the closest thing we have to an international language. I don't think you could reasonably conclude from English language menus that a product was destined for the USA but I would expect he was aware of the markets in which his company trades anyway; I just don't think that makes him liable for his employer complying with the laws in those countries or failing to do so.

      For example, if a man works writing computer games and is asked to translate the messages in the game into French (whether he does the translation himself or whether he just inserts text provided to him by his employer) then I don't think it's a reasonable expectation that he should be liable to prosecution if the game is illegal under French law for e.g. excessive violence. All he should have to worry about is whether it is lawful for him to write the game in the jurisdiction in which he does so and to enter into the contract with his employer in the jurisdiction in which he does so. Expecting him (as opposed to his employer or the distributor or whoever was actually trading in those markets) to obtain legal advice on all aspects of the product for all export markets is wholly unreasonable.

      I don't know what you do for a living but you can apply this reasoning to most products. "You designed this seat belt for Ford, you knew one of their markets is Turkey, you are liable for the failure to comply with the Turkish law that requires..."

  167. Re:"Effectively" doesn't mean what you think it do by iabervon · · Score: 2

    [IANALE]

    That sounds to me like the method of gaining access needs to have a secret process or information (i.e., key); otherwise the "with the authority of the copyright owner" bit fails.

    That is, I can't release a version of gv that checks whether you're the authorized person, release a normal PDF document, and sue Adobe because their program breaks my scheme. Although, in the normal course of operation (of my program), you need my permission to access the document, you don't need to use information or a process or a treatment that requires my permission.

    It's not so much that eBooks are easily broken as that there's nothing particular novel about the way to do it. Breaking CSS, for instance, requires a specialized program, whereas eBooks can be broken without anything specialized.